SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g05540

Feature Type:gene_model
Chromosome:Gm02
Start:4434895
stop:4436826
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g05540
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G36130AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L2 family | chr4:17097613-17098656 FORWARD LENGTH=258 SoyBaseE_val: 0ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG2309 KOG 60s ribosomal protein L2/L8 JGI ISS
PTHR13691Panther RIBOSOMAL PROTEIN L2 JGI ISS
PTHR13691:SF4Panther gb def: 60s ribosomal protein l8 [encephalitozoon cuniculi] JGI ISS
PF00181PFAM Ribosomal Proteins L2, RNA binding domain JGI ISS
PF03947PFAM Ribosomal Proteins L2, C-terminal domain JGI ISS
UniRef100_I1MN72UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MN72_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9FEZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L2 n=1 Tax=Glycine max RepID=Q9FEZ7_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g05540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g05540
ParalogEvidenceComments
Glyma16g24120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g05540 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g049300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g05540
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g05540
>Glyma02g05540.1   sequence type=CDS   gene model=Glyma02g05540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACGTGTGATCCGTGCGCAGCGTAAGGGAGCAGGCTCGGTCTTCAAGTCCCACACGCACCACCGCAAGGGCCCTGCCCGCTTCCGGAGCCTGGATTTCGGAGAGCGCAACGGCTACCTGAAGGGTGTCGTCACTGACGTCATCCACGATCCTGGCCGTGGCGCGCCTCTCGCTAAGGTCGCCTTCCGCCACCCGTTCCGCTACAAGAAGCAGAACGAGCTCTTCATCGCCGCCGAGGGTCTCTACACCGGCCAGTTCATCTACTGCGGCAAGAAGGCCACCCTCGTTGTCGGCAATGTGTTGCCTCTTCGATCCATTCCTGAAGGAGCTGTCATCTGCAACGTCGAGCACCATGTCGGCGACCGCGGCGTCTTCGCTAGGGCGTCTGGAGACTACGCCATTGTTATCAGTCACAACCCTGATAATGACACCTCTAGGATTAAGCTCCCATCTGGTTCAAAGAAGATTGTTCCAAGTGACTGTAGGGCCATGATTGGTCAAGTTGCAGGTGGAGGGAGAACTGAGAAGCCTCTTCTCAAGGCTGGAAATGCTTACCACAAGTTCAGAGTGAAGAGGAATTGCTGGCCCAAGGTTCGTGGTGTTGCTATGAACCCTGTTGAGCATCCCCACGGAGGAGGTAATCACCAGCATATTGGTCACGCAAGTACTGTCAGGCGTGATGCTCCTCCTGGACAGAAGGTTGGTCTCATTGCTGCTAGGAGGACTGGTCGTCTTAGAGGACAAGCTGCTGCAACTGCTGCCAAGGCTGATAAGGCTTAA
Predicted protein sequences of Glyma02g05540
>Glyma02g05540.1   sequence type=predicted peptide   gene model=Glyma02g05540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAKVAFRHPFRYKKQNELFIAAEGLYTGQFIYCGKKATLVVGNVLPLRSIPEGAVICNVEHHVGDRGVFARASGDYAIVISHNPDNDTSRIKLPSGSKKIVPSDCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADKA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo