Glyma02g05390 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g05390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g05390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g05390

Feature Type:	gene_model
Chromosome:	Gm02
Start:	4350446
stop:	4351452
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g05390

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G17880	AT	Annotation by Michelle Graham. TAIR10: Chaperone DnaJ-domain superfamily protein \| chr2:7767176-7767658 REVERSE LENGTH=160	SoyBase	E_val: 1.00E-36	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0031072	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding	SoyBase	N/A	ISS
PTHR25040	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR25040:SF170	Panther		JGI		ISS
PF00226	PFAM	DnaJ domain	JGI		ISS
UniRef100_P93499	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DnaJ-like protein (Fragment) n=1 Tax=Phaseolus vulgaris RepID=P93499_PHAVU	SoyBase	E_val: 4.00E-40	ISS
UniRef100_UPI0001FBDBF7	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0001FBDBF7 related cluster n=1 Tax=unknown RepID=UPI0001FBDBF7	SoyBase	E_val: 5.00E-69	ISS

Expression Patterns of Glyma02g05390

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g05390 not represented in the dataset	Glyma02g05390 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g05390

Paralog	Evidence	Comments
Glyma16g23740	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g05390 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g047900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g05390

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g05390

Limit To All Plant Sequences

>Glyma02g05390.2   sequence type=CDS   gene model=Glyma02g05390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCGAGCGCGACGCTCTACCAGATTCTGGGAGTCCGCGCCGTCGCATCCGGCGAGGAAATCAAGGCGGCGTACCGGCGGCTGGCGAGGGTTTGCCACCCTGACGTGGTGCCGTTGGAGCGAAGGGATTCCTCTGCGGCAGAGTTTATGAAGATCCACGCCGCATACCGCACGCTATCGGATCCTGAGAAGCGGGCCAGTTATGATAGAAGCTTGTTCCGGCGGCGCCAGCGGACGCTAACAATGTCTCCGTCGGGGTATTGTGGCTATGGTGGTCGGAACTGGGAAACGGACCAATGTTGGTAG

Predicted protein sequences of Glyma02g05390

Limit To All Plant Sequences

>Glyma02g05390.2   sequence type=predicted peptide   gene model=Glyma02g05390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSATLYQILGVRAVASGEEIKAAYRRLARVCHPDVVPLERRDSSAAEFMKIHAAYRTLSDPEKRASYDRSLFRRRQRTLTMSPSGYCGYGGRNWETDQCW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain