Glyma02g05370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g05370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g05370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g05370

Feature Type:	gene_model
Chromosome:	Gm02
Start:	4344418
stop:	4346972
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g05370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G17360	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein S4 (RPS4A) family protein \| chr2:7546598-7548138 FORWARD LENGTH=261	SoyBase	E_val: 0	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0022627	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0378	KOG	40S ribosomal protein S4	JGI		ISS
PTHR11581	Panther	30S/40S RIBOSOMAL PROTEIN S4	JGI		ISS
PF00467	PFAM	KOW motif	JGI		ISS
PF00900	PFAM	Ribosomal family S4e	JGI		ISS
PF01479	PFAM	S4 domain	JGI		ISS
PF08071	PFAM	RS4NT (NUC023) domain	JGI		ISS
UniRef100_Q8LJW0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal S4 protein n=2 Tax=Glycine max RepID=Q8LJW0_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_UPI00019AA892	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00019AA892 related cluster n=1 Tax=unknown RepID=UPI00019AA892	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma02g05370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g05370 not represented in the dataset	Glyma02g05370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g05370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g047800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g05370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g05370

Limit To All Plant Sequences

>Glyma02g05370.1   sequence type=CDS   gene model=Glyma02g05370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAGAGGATTGAAGAAGCATTTGAAGAGGCTTAATGCCCCAAAGCATTGGATGCTTGACAAACTGGGTGGTGCATTTGCTCCTAAGCCCTCATCTGGACCACACAAATCCAGGGAATGCCTGCCACTCATACTCATTTTGCGAAACCGGCTGAAGTATGCTCTGACATACCGTGAAGTCATTGCTATTCTGATGCAGCGACATGTCCTTGTTGATGGCAAAGTCAGGACAGACAAGACATATCCTGCTGGTTTCATGGATGTTGTATCAATCCCTAAAACAAATGAGAACTTCCGCCTGCTGTATGACACCAAAGGCCGATTCCGTCTTCACTCAGTCATAGATGACGAGGCTAAGTTCAAGCTTTGCAAAGTTCGCTCAGTGCAGTTTGGGCAAAAAGGTATCCCATACTTGAACACCTACGATGGTCGCACTATCCGCTACCCAGACCCTCTCATCAGAGCTAATGACACCATTAAGTTGGATTTGGAGGAGAACAAGATTGTCGATTTCATCAAGTTTGATGTTGGGAATGTAGTCATGGTGACAGGTGGAAGGAATAGGGGTCGTGTTGGAGTGATCAAGAACAGAGAGAAGCATAAGGGAAGCTTTGAGACTATCCATGTTCAGGATGCCACTGGCCACGAGTTTGCAACTCGTATGGGCAATGTGTTCACCATTGGCAAGGGAACAAAACCATGGATATCTCTTCCCAAGGGTAAAGGTATTAAACTATCAATCATTGAGGAAGCTAGGAAAAGGATTGCCGCCCAACAAGCAACTGCTGCTTAA

Predicted protein sequences of Glyma02g05370

Limit To All Plant Sequences

>Glyma02g05370.1   sequence type=predicted peptide   gene model=Glyma02g05370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHVQDATGHEFATRMGNVFTIGKGTKPWISLPKGKGIKLSIIEEARKRIAAQQATAA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain