SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g05120

Feature Type:gene_model
Chromosome:Gm02
Start:4151925
stop:4153960
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g05120
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75950AT Annotation by Michelle Graham. TAIR10: S phase kinase-associated protein 1 | chr1:28516715-28517454 FORWARD LENGTH=160 SoyBaseE_val: 5.00E-83ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0007140GO-bp Annotation by Michelle Graham. GO Biological Process: male meiosis SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042752GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0045910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of DNA recombination SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0000151GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ubiquitin ligase complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005819GO-cc Annotation by Michelle Graham. GO Cellular Compartment: spindle SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009524GO-cc Annotation by Michelle Graham. GO Cellular Compartment: phragmoplast SoyBaseN/AISS
GO:0019005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1724 KOG SCF ubiquitin ligase, Skp1 component JGI ISS
PTHR11165Panther SKP1 JGI ISS
PF01466PFAM Skp1 family, dimerisation domain JGI ISS
PF03931PFAM Skp1 family, tetramerisation domain JGI ISS
UniRef100_C6TH23UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TH23_SOYBN SoyBaseE_val: 2.00E-108ISS
UniRef100_Q155U3UniRef Annotation by Michelle Graham. Most informative UniRef hit: SKP1-like a n=1 Tax=Medicago truncatula RepID=Q155U3_MEDTR SoyBaseE_val: 9.00E-92ISS

Expression Patterns of Glyma02g05120
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g05120
ParalogEvidenceComments
Glyma16g23230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g05120 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g045700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g05120
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g05120
>Glyma02g05120.1   sequence type=CDS   gene model=Glyma02g05120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCGACGAAGAAGATCACACTGAAGAGTTCGGACGGCGAGGCCTTCGAGGTGGAGGAGGCGGTGGCGGTGGAGTCCCAGACGATCAAGCACATGATCGAGGACAACTGCGCCGACAGCGGAATTCCTCTCCCCAATGTTACCAGCAAGATTCTGGCCAAGGTTATCGAGTATTGCAAGAAGCACGTTGAGGCCAATTGCGCTGATGAGAAGCCCAGTGAGGATGAACTCAAGGCTTGGGACGCTGATTTCGTCAAGGTTGATCAGGCCACACTCTTTGATCTCATTCTGGCTGCAAATTACTTGAATATCAAGAGCCTTTTGGACCTTACTTGCCAGACAGTAGCAGACATGATCAAGGGAAAGACTCCTGAGGAAATTCGCAAGACATTCAACATCAAGAATGACTTCACCCCTGAGGAAGAGGAGGAAGTTCGTAGGGAAAACCAATGGGCCTTTGAATGA
Predicted protein sequences of Glyma02g05120
>Glyma02g05120.1   sequence type=predicted peptide   gene model=Glyma02g05120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTKKITLKSSDGEAFEVEEAVAVESQTIKHMIEDNCADSGIPLPNVTSKILAKVIEYCKKHVEANCADEKPSEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo