| 
 | 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT2G38290 | AT | Annotation by Michelle Graham. TAIR10: ammonium transporter 2 | chr2:16039672-16042291 REVERSE LENGTH=475 | SoyBase | E_val: 2.00E-173 | ISS | 
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS | 
| GO:0002237 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin | SoyBase | N/A | ISS | 
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS | 
| GO:0006820 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anion transport | SoyBase | N/A | ISS | 
| GO:0006862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide transport | SoyBase | N/A | ISS | 
| GO:0006888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport | SoyBase | N/A | ISS | 
| GO:0006995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation | SoyBase | N/A | ISS | 
| GO:0007154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell communication | SoyBase | N/A | ISS | 
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS | 
| GO:0009581 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of external stimulus | SoyBase | N/A | ISS | 
| GO:0009595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus | SoyBase | N/A | ISS | 
| GO:0009624 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nematode | SoyBase | N/A | ISS | 
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS | 
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS | 
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS | 
| GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS | 
| GO:0009749 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus | SoyBase | N/A | ISS | 
| GO:0009750 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus | SoyBase | N/A | ISS | 
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS | 
| GO:0009863 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway | SoyBase | N/A | ISS | 
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS | 
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS | 
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS | 
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS | 
| GO:0015695 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organic cation transport | SoyBase | N/A | ISS | 
| GO:0015696 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ammonium transport | SoyBase | N/A | ISS | 
| GO:0015802 | GO-bp | Annotation by Michelle Graham. GO Biological Process: basic amino acid transport | SoyBase | N/A | ISS | 
| GO:0030968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response | SoyBase | N/A | ISS | 
| GO:0031347 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of defense response | SoyBase | N/A | ISS | 
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS | 
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS | 
| GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS | 
| GO:0043090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid import | SoyBase | N/A | ISS | 
| GO:0043269 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of ion transport | SoyBase | N/A | ISS | 
| GO:0043900 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process | SoyBase | N/A | ISS | 
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS | 
| GO:0051707 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to other organism | SoyBase | N/A | ISS | 
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS | 
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS | 
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS | 
| GO:0008519 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ammonium transmembrane transporter activity | SoyBase | N/A | ISS | 
| GO:0015398 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: high affinity secondary active ammonium transmembrane transporter activity | SoyBase | N/A | ISS | 
| KOG0682 | KOG | Ammonia permease | JGI | ISS | |
| PTHR11730 | Panther | AMMONIUM TRANSPORTER | JGI | ISS | |
| PTHR11730:SF1 | Panther | AMMONIUM TRANSPORTER | JGI | ISS | |
| PF00909 | PFAM | Ammonium Transporter Family | JGI | ISS | |
| UniRef100_G7LAA8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ammonium transporter 3 member n=1 Tax=Medicago truncatula RepID=G7LAA8_MEDTR | SoyBase | E_val: 0 | ISS | 
| UniRef100_I1JCC7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JCC7_SOYBN | SoyBase | E_val: 0 | ISS | 
| Glyma02g04960 not represented in the dataset | Glyma02g04960 not represented in the dataset | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection | Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.02g043700 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 | 
>Glyma02g04960.1 sequence type=CDS gene model=Glyma02g04960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGTTCTAGTTCTTATGATATCCCTTTGCCATCGTCCCTTTTGCCAAGCGAGGCATCGCCGGAGTGGAACAACAAAGCAGACAACGCGTGGCAGCTCACGGCGGCAACCCTAGTGGGCCTCCAGAGCGTTCCCGGGCTCGTGATCCTATATGGCAGCATGGTAAAGCGCAAATGGGCCGTGAACTCGGCGTTCATGGCCCTGTACGCCTTCGCGTGTGTGCTCATTTGTTGGGTTTCATGGGCACACCGCATGGCGTTCGGGGCCAGGCTTTTACCCTTTGTGGGAGCGCCCAACCATGCCTTGGCCGAGAAGTTTCTCCTCGCAAAGTCAACAATTGGGTATTTTCCAATGGCTGACTTTGTGTTCTACCAGTTTGCTTTTGCCGCAATTACTCTTGTGTTGCTTGCAGGGTCCTTGCTTGGGAGAATGAACTTCTATGCGTGGATGATGTTTGTCCCTTTGTGGCTTACGTTGTCTTATACCGTTGGTGCCTTCAGCATATGGGACGATGATGGGTTCCTTCAGGGAAAAATAATTGACTATGCTGGTGGGTTTGTCATTCATTTGTCTTCTGGCGTTGGTCCAAGAATTTCACAGGACAGGCAAAACTTTCCACCAAACAACATAATTCACGTGCTTGGAGGTGCAGGGTTTTTGTGGATGGGTTGGACAGGTTTCAATGGTGGAGCTCCATTTCAAGTGGGAGAAATCGCATCCTTGGCCATTTACAATACCCATCTTTGCACTGCCACAAGCCTACTCGTTTGGCTTACGCTTGACATGATTGTATATACCAAGAGCTCAGTCATAGGTGCTGTCCAGGGAATGATCACTGGCCTCGTCTGCATCACACCAGGTGCAGGCTTGGTGGATCCATGGGCAGCAGTATTGATGGGAGCATTGTCTGGTTCCATTCCATGGTACACAATGATGGTGCTACACAAAAAATCCGCATTCTTTCAAAGTGTAGATGACACATTAGGAGTCTTTCACACTCATGCTGTGGCTGGTCTTCTTGGGGGTATCCTTTCTGGCGTGTTTGCCAAACCCGACCTTCTAAGAATAATGTATCAAGATACAAATTATTGCCCCGGCTTATTCTACACCTTTTTTAAGGGGGAAGTGGACCATGGCTTTAGGCAAATTTGGTACCAATTACTTGGAGCAGGTTTTATTATTGTTTGGAATGTTGTTATTACTAGCCTCATTTGTATTCTCATAAGCCGCATTGTGGATCTTAGGATGAAAGAAGAGGATCTTGAGGTTGGTGATGATGCTGCCCATGGGGAAGAAGCATATGCATTGTGGGGTGATGGAGAGAGAATGAGGATCCCTCTTCGTCTTCATATAGGTCCAACAATTCCTTCCTTGTGCCGAAAAAGGTTTTCAATTCCTCTCACTAGGAAAGAAGGAGAATAG
>Glyma02g04960.1 sequence type=predicted peptide gene model=Glyma02g04960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSSSSYDIPLPSSLLPSEASPEWNNKADNAWQLTAATLVGLQSVPGLVILYGSMVKRKWAVNSAFMALYAFACVLICWVSWAHRMAFGARLLPFVGAPNHALAEKFLLAKSTIGYFPMADFVFYQFAFAAITLVLLAGSLLGRMNFYAWMMFVPLWLTLSYTVGAFSIWDDDGFLQGKIIDYAGGFVIHLSSGVGPRISQDRQNFPPNNIIHVLGGAGFLWMGWTGFNGGAPFQVGEIASLAIYNTHLCTATSLLVWLTLDMIVYTKSSVIGAVQGMITGLVCITPGAGLVDPWAAVLMGALSGSIPWYTMMVLHKKSAFFQSVDDTLGVFHTHAVAGLLGGILSGVFAKPDLLRIMYQDTNYCPGLFYTFFKGEVDHGFRQIWYQLLGAGFIIVWNVVITSLICILISRIVDLRMKEEDLEVGDDAAHGEEAYALWGDGERMRIPLRLHIGPTIPSLCRKRFSIPLTRKEGE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||