Glyma02g04520 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g04520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g04520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g04520

Feature Type:	gene_model
Chromosome:	Gm02
Start:	3684741
stop:	3686311
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g04520

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G24380	AT	Annotation by Michelle Graham. TAIR10: INVOLVED IN: 10-formyltetrahydrofolate biosynthetic process, folic acid and derivative biosynthetic process; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Serine hydrolase (InterPro:IPR005645); BEST Arabidopsis thaliana protein match is: alpha/beta-Hydrolases superfamily protein (TAIR:AT5G65400.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Oth	SoyBase	E_val: 3.00E-91	ISS
GO:0009257	GO-bp	Annotation by Michelle Graham. GO Biological Process: 10-formyltetrahydrofolate biosynthetic process	SoyBase	N/A	ISS
GO:0009396	GO-bp	Annotation by Michelle Graham. GO Biological Process: folic acid-containing compound biosynthetic process	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0015824	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
KOG2551	KOG	Phospholipase/carboxyhydrolase	JGI		ISS
PTHR22778	Panther	OVARIAN CANCER GENE-2 PROTEIN-RELATED	JGI		ISS
PF03959	PFAM	Serine hydrolase (FSH1)	JGI		ISS
UniRef100_G7JXR7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ovarian cancer-associated gene 2 protein-like protein n=1 Tax=Medicago truncatula RepID=G7JXR7_MEDTR	SoyBase	E_val: 3.00E-120	ISS
UniRef100_I1JC83	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JC83_SOYBN	SoyBase	E_val: 3.00E-147	ISS

Expression Patterns of Glyma02g04520

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g04520 not represented in the dataset	Glyma02g04520 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g04520 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g039800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g04520

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g04520

Limit To All Plant Sequences

>Glyma02g04520.2   sequence type=CDS   gene model=Glyma02g04520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGATCACGAAAGCCAGAGAAAACTCAGAATCCTGTGCCTCCATGGATTCAGGACTAGTAGTGAAATTCTCAAGCAATTAGTCTTAAGATGGCCTGAACCTGTCTTACAAAAGCTGAACTTTGTATTCCTCGATGGCCAGTTTCTCGCACAGGGAAGATCTGATGTTGAAGGCATTTTTGACCCTCCTTATTATGAATGGTTCCAAGCCAATGAGGACTTCACTGAGTATACCAACTTTGAAGAATGTTTAGTATACATTGAAGATTACATGCTGAAAAATGGTCCTTTTGATGGTTTATTGGGTTTCTCTCAGGGAGCAGTTTTAGCAGCTGCATTGCTAGGATTGCAAGCACAGGGTGTGGCACTTGGGAAGGTGAACAAGATCAAGTTCCTGATTGTGATATCAGGAGCTAAGTTTGGTGGAAGAAAGTACGGAATGCCTAAACTGGCTGCTAATCCATATTCAAAACAAATGGATTGCCCGTCTCTTCACTTTATAGGGGAGAAGGATTTTGCGAAGCCAGACAGCATTGCTTTGTTGGAAGCATTCAAGGATCCTATGGTGATTCACCACCCTAAAGGGCACACAGTTCCTAGACTTGATGATAAGGGTCTTCAAACTATGCTCGGTTTCATTAACACAATTCAGACTAGGAAGACCTGTTCAAGACTTTAA

Predicted protein sequences of Glyma02g04520

Limit To All Plant Sequences

>Glyma02g04520.2   sequence type=predicted peptide   gene model=Glyma02g04520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDHESQRKLRILCLHGFRTSSEILKQLVLRWPEPVLQKLNFVFLDGQFLAQGRSDVEGIFDPPYYEWFQANEDFTEYTNFEECLVYIEDYMLKNGPFDGLLGFSQGAVLAAALLGLQAQGVALGKVNKIKFLIVISGAKFGGRKYGMPKLAANPYSKQMDCPSLHFIGEKDFAKPDSIALLEAFKDPMVIHHPKGHTVPRLDDKGLQTMLGFINTIQTRKTCSRL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain