|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G07650 | AT | Annotation by Michelle Graham. TAIR10: Leucine-rich repeat transmembrane protein kinase | chr1:2359817-2366423 REVERSE LENGTH=1020 | SoyBase | E_val: 2.00E-18 | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0007169 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane receptor protein tyrosine kinase signaling pathway | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0004713 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| PF11721 | PFAM | Di-glucose binding within endoplasmic reticulum | JGI | ISS | |
| UniRef100_B9SEU2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9SEU2_RICCO | SoyBase | E_val: 5.00E-29 | ISS |
| UniRef100_I1M2X2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M2X2_SOYBN | SoyBase | E_val: 3.00E-39 | ISS |
|
Glyma02g04161 not represented in the dataset |
Glyma02g04161 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g036600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g04161.1 sequence type=CDS gene model=Glyma02g04161 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTTCAAATTCTGATCCTTTGCTTCTTGTTACAGATGTTGAATCTCTACATATAAATTGTGGTGGAAAGCAGGTTGTTGTTGGAGATATAACATATGATGAAGATATGGATTCAGCTGGACCAACAGTTTTTAAACAAAGTAGAAATAATTGGACATTTAGCAACACAGGTCACTTCGTGGTCAATGATACTTTAGCTAAACAAGGAAAGCTTCCAGCCTATGCCACAGAAAATGAAACCAGGCTTTATATGACTGATGCCGAATTATATAAGAATGCACGTATTTCCCCCATATCTTTGACTTATTATGGATTTTGCTTGGAAAATGGAGACTACACAGTAAAGCCATACTTTGCTTAG
>Glyma02g04161.1 sequence type=predicted peptide gene model=Glyma02g04161 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVSNSDPLLLVTDVESLHINCGGKQVVVGDITYDEDMDSAGPTVFKQSRNNWTFSNTGHFVVNDTLAKQGKLPAYATENETRLYMTDAELYKNARISPISLTYYGFCLENGDYTVKPYFA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||