Report for Sequence Feature Glyma02g03265
Feature Type: gene_model
Chromosome: Gm02
Start: 2521893
stop: 2522501
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma02g03265
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G59970 AT
Annotation by Michelle Graham. TAIR10: Matrixin family protein | chr1:22073601-22074683 FORWARD LENGTH=360
SoyBase E_val: 3.00E-21 ISS
GO:0006508 GO-bp
Annotation by Michelle Graham. GO Biological Process: proteolysis
SoyBase N/A ISS
GO:0008152 GO-bp
Annotation by Michelle Graham. GO Biological Process: metabolic process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0031012 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix
SoyBase N/A ISS
GO:0031225 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane
SoyBase N/A ISS
GO:0004222 GO-mf
Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity
SoyBase N/A ISS
GO:0008237 GO-mf
Annotation by Michelle Graham. GO Molecular Function: metallopeptidase activity
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR10201 Panther
MATRIX METALLOPROTEINASE
JGI ISS
PTHR10201:SF15 Panther
MATRIX METALLOPROTEINASE-RELATED
JGI ISS
PF00413 PFAM
Matrixin
JGI ISS
UniRef100_I1J5F1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1J5F1_SOYBN
SoyBase E_val: 5.00E-59 ISS
UniRef100_Q93Z89 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Matrix metalloproteinase MMP2 n=1 Tax=Glycine max RepID=Q93Z89_SOYBN
SoyBase E_val: 7.00E-55 ISS
Expression Patterns of Glyma02g03265
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma02g03265
Paralog Evidence Comments
Glyma01g04370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma02g03265 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.02g028300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma02g03265
Coding sequences of Glyma02g03265
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma02g03265.1 sequence type=CDS gene model=Glyma02g03265 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
AACAATAACTGCTACCAGCAATATTTCAATCTGGAAGTTACCGACTACCTAAACGACAAGACGTTTCAGCAAATCTCGCTGCCGCGATGTGGCGTCCCTGACATGAATTTCGACTACGGCTTCACCGGCAACGTGTCATGGCCGAAAACCAGGAACCGGTGGTTCCCGGAGAGAAACCACCTCACCTACGGTTTTGATCCGGCAAGCCATATCCAACCCAACGTGAAAAAGATTTTCAGAGATGCCTTCAAGAGGTGGGCGCAGGCCACCACAGGGGTATTTAGCCTAAGCTTTATCATACTGCAACCTGGCTCTAATGTCACGACAGGGGACATACGCCTCAAAGGTGCCATGTTATGGTTGCTGCCGAGTGAAAACGAGAGCCTGTCGTGGGAGGACGGAGTTTTGGACTTGGAGAGTGCGGCGATGCATCTTCTAGGGCTTGACCACTCTAACAAAGAGGGCTCTGTTATGTACCCTAACGTATTGCCATGGCAGCAACGAAAGGTGGAGCTCTCGGTTTCTGAT
Predicted protein sequences of Glyma02g03265
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma02g03265.1 sequence type=predicted peptide gene model=Glyma02g03265 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
NNNCYQQYFNLEVTDYLNDKTFQQISLPRCGVPDMNFDYGFTGNVSWPKTRNRWFPERNHLTYGFDPASHIQPNVKKIFRDAFKRWAQATTGVFSLSFIILQPGSNVTTGDIRLKGAMLWLLPSENESLSWEDGVLDLESAAMHLLGLDHSNKEGSVMYPNVLPWQQRKVELSVSD