SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g03265): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g03265): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g03265

Feature Type:gene_model
Chromosome:Gm02
Start:2521893
stop:2522501
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G59970AT Annotation by Michelle Graham. TAIR10: Matrixin family protein | chr1:22073601-22074683 FORWARD LENGTH=360 SoyBaseE_val: 3.00E-21ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031012GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0004222GO-mf Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity SoyBaseN/AISS
GO:0008237GO-mf Annotation by Michelle Graham. GO Molecular Function: metallopeptidase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR10201Panther MATRIX METALLOPROTEINASE JGI ISS
PTHR10201:SF15Panther MATRIX METALLOPROTEINASE-RELATED JGI ISS
PF00413PFAM Matrixin JGI ISS
UniRef100_I1J5F1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1J5F1_SOYBN SoyBaseE_val: 5.00E-59ISS
UniRef100_Q93Z89UniRef Annotation by Michelle Graham. Most informative UniRef hit: Matrix metalloproteinase MMP2 n=1 Tax=Glycine max RepID=Q93Z89_SOYBN SoyBaseE_val: 7.00E-55ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g03265 not represented in the dataset

Glyma02g03265 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g04370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g028300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g03265.1   sequence type=CDS   gene model=Glyma02g03265   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AACAATAACTGCTACCAGCAATATTTCAATCTGGAAGTTACCGACTACCTAAACGACAAGACGTTTCAGCAAATCTCGCTGCCGCGATGTGGCGTCCCTGACATGAATTTCGACTACGGCTTCACCGGCAACGTGTCATGGCCGAAAACCAGGAACCGGTGGTTCCCGGAGAGAAACCACCTCACCTACGGTTTTGATCCGGCAAGCCATATCCAACCCAACGTGAAAAAGATTTTCAGAGATGCCTTCAAGAGGTGGGCGCAGGCCACCACAGGGGTATTTAGCCTAAGCTTTATCATACTGCAACCTGGCTCTAATGTCACGACAGGGGACATACGCCTCAAAGGTGCCATGTTATGGTTGCTGCCGAGTGAAAACGAGAGCCTGTCGTGGGAGGACGGAGTTTTGGACTTGGAGAGTGCGGCGATGCATCTTCTAGGGCTTGACCACTCTAACAAAGAGGGCTCTGTTATGTACCCTAACGTATTGCCATGGCAGCAACGAAAGGTGGAGCTCTCGGTTTCTGAT

>Glyma02g03265.1   sequence type=predicted peptide   gene model=Glyma02g03265   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NNNCYQQYFNLEVTDYLNDKTFQQISLPRCGVPDMNFDYGFTGNVSWPKTRNRWFPERNHLTYGFDPASHIQPNVKKIFRDAFKRWAQATTGVFSLSFIILQPGSNVTTGDIRLKGAMLWLLPSENESLSWEDGVLDLESAAMHLLGLDHSNKEGSVMYPNVLPWQQRKVELSVSD







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo