Glyma02g03140 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g03140

Feature Type:	gene_model
Chromosome:	Gm02
Start:	2436721
stop:	2438416
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g03140

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G59940	AT	Annotation by Michelle Graham. TAIR10: response regulator 3 \| chr1:22065894-22066895 REVERSE LENGTH=231	SoyBase	E_val: 8.00E-70	ISS
GO:0000160	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007623	GO-bp	Annotation by Michelle Graham. GO Biological Process: circadian rhythm	SoyBase	N/A	ISS
GO:0009735	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus	SoyBase	N/A	ISS
GO:0009736	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0010114	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to red light	SoyBase	N/A	ISS
GO:0010161	GO-bp	Annotation by Michelle Graham. GO Biological Process: red light signaling pathway	SoyBase	N/A	ISS
GO:0042752	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0000156	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity	SoyBase	N/A	ISS
PTHR26402	Panther	RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM	JGI		ISS
PTHR26402:SF57	Panther		JGI		ISS
PF00072	PFAM	Response regulator receiver domain	JGI		ISS
UniRef100_B0YGG5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Type A response regulator RR1 n=1 Tax=Phaseolus vulgaris RepID=B0YGG5_PHAVU	SoyBase	E_val: 2.00E-110	ISS
UniRef100_I1JBW0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBW0_SOYBN	SoyBase	E_val: 9.00E-170	ISS

Proteins Associated with Glyma02g03140

Locus	Gene Symbol	Protein Name
	RR01	Ubiquitous, Response Regulator Type-A

Expression Patterns of Glyma02g03140

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g03140

Paralog	Evidence	Comments
Glyma01g04421	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g03140 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g027400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g03140

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g03140

Limit To All Plant Sequences

>Glyma02g03140.1   sequence type=CDS   gene model=Glyma02g03140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACACGGACAGCTTCGTTTCCTTCGATCATGTTTCGCCGGAGGATTCCCACGAGGTTCATGTCTTGGCCGTTGATGACAGCCTCGTCGATCGAAAGGTCATTGAACGCTTGCTTAAAATCTCAGCTTGTAAAGTTACTGCTGTGGATAGTGGAATCAGAGCACTGCAGTTTCTGGGGCTGGACGAGCAGAGAAGGACCTCTGAATCTGATGGTTTTGTCCCGGATTTGAAGGTGGATCTAATTATCACTGACTACTGCATGCCCGAAATGACCGGTTACGAGTTGCTCAAGAAAATCAAGGAATCGACCATGTTCAGAGAAATTCCAGTAGTGATCATGTCTTCCGAAAACATTTTGCCGCGCATAGACAGATGTTTGGAAGAAGGTGCAGAGGATTTCATAGTAAAGCCAGTGAAATTATCTGATGTAAAACGGTTAAAGGGTTACATGACACCCAAAGAGGTTATTAAGATGAGAAGCCAAGAAGACAGAAGAAGTGATGGCTATGTTAACGGTGGTGATGGTGGTGTTCTGGAGATAAACAACAAAAGAAAGCTGGAAGAGCAAGACACCTCTGACGTGTCATTATCACCACCGTCAACTTCTACCCTTTCATCATCACCGTCCGTTTCCTCACCATCACCGTCATCTTCTCCTACTTCTTCAGCCAGCGTGCTTGCCTCTCCAATCAGACGGCTTAAAATGACCAGCACCGATTGA

Predicted protein sequences of Glyma02g03140

Limit To All Plant Sequences

>Glyma02g03140.1   sequence type=predicted peptide   gene model=Glyma02g03140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDTDSFVSFDHVSPEDSHEVHVLAVDDSLVDRKVIERLLKISACKVTAVDSGIRALQFLGLDEQRRTSESDGFVPDLKVDLIITDYCMPEMTGYELLKKIKESTMFREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTPKEVIKMRSQEDRRSDGYVNGGDGGVLEINNKRKLEEQDTSDVSLSPPSTSTLSSSPSVSSPSPSSSPTSSASVLASPIRRLKMTSTD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain