SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g03100

Feature Type:gene_model
Chromosome:Gm02
Start:2414696
stop:2415880
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g03100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10460AT Annotation by Michelle Graham. TAIR10: germin-like protein 7 | chr1:3439578-3440231 REVERSE LENGTH=217 SoyBaseE_val: 4.00E-81ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0030145GO-mf Annotation by Michelle Graham. GO Molecular Function: manganese ion binding SoyBaseN/AISS
GO:0045735GO-mf Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity SoyBaseN/AISS
PF00190PFAM Cupin JGI ISS
UniRef100_C6T0Q1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0Q1_SOYBN SoyBaseE_val: 3.00E-157ISS
UniRef100_C7S8B9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 5 n=1 Tax=Glycine max RepID=C7S8B9_SOYBN SoyBaseE_val: 4.00E-152ISS

Expression Patterns of Glyma02g03100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g03100
ParalogEvidenceComments
Glyma01g04450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g03100 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g027000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g03100
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g03100
>Glyma02g03100.1   sequence type=CDS   gene model=Glyma02g03100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAACCCATTTTCACTCTCTCCCATTATTTTTTTGGTTCACTCTATCCCTTATATTGGGTCAAACCCGACCCGACCCTGACCCACTTCAAGATTATTGTGTTGCAGATAGCAAAAGTAATTTTTTCATTAATGGGGTACCTTGCATTAACCCAGATAAAGTTTCCTCATCCCATTTTGTCACATCTGCTTTATCAAAAACTGGCAACACTAGTAACCAATTTGGCTTCAGTGTCACAGCCACCACCACTGCTAATCTTCCTGGGCTTAACACCTTGGGCCTGGTACTGGTCCGGGTCGATATAGCGGGCAACGGGATAGTGCCACCTCACTCGCATCCGAGGGCCTCGGAAGTTACCACTTGCCTAAAGGGCCTGCTTCTTGTGGGCTTTGTTGACACAAGTAACCGTGTCTTTACCCAGAACTTGAGGCCTGGTGAGTCATTTGTGTTCCCAAAGGGCCTGGTCCACTTCTTGTTCAATAGTGATTCAAGGGAACCAGCAATAGCCATATCTGGTCTCAATAGCCAGAACCCAGGAGCACAAATTGCATCACTTGCAACATTTGCTAGCAAGCCTCCTATTCCTGATGACATTCTTAAGAAAGCTTTCCAAATTTCCAAAGGAGAAGTGGAAACTATTCGTAGAAACCTTGGAGGATGA
Predicted protein sequences of Glyma02g03100
>Glyma02g03100.1   sequence type=predicted peptide   gene model=Glyma02g03100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRTHFHSLPLFFWFTLSLILGQTRPDPDPLQDYCVADSKSNFFINGVPCINPDKVSSSHFVTSALSKTGNTSNQFGFSVTATTTANLPGLNTLGLVLVRVDIAGNGIVPPHSHPRASEVTTCLKGLLLVGFVDTSNRVFTQNLRPGESFVFPKGLVHFLFNSDSREPAIAISGLNSQNPGAQIASLATFASKPPIPDDILKKAFQISKGEVETIRRNLGG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo