Glyma02g02980 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02980

Feature Type:	gene_model
Chromosome:	Gm02
Start:	2280170
stop:	2282253
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g02980

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G69970	AT	Annotation by Michelle Graham. TAIR10: CLAVATA3/ESR-RELATED 26 \| chr1:26353079-26354256 REVERSE LENGTH=102	SoyBase	E_val: 7.00E-13	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0005102	GO-mf	Annotation by Michelle Graham. GO Molecular Function: receptor binding	SoyBase	N/A	ISS
GO:0033612	GO-mf	Annotation by Michelle Graham. GO Molecular Function: receptor serine/threonine kinase binding	SoyBase	N/A	ISS
UniRef100_C6SX48	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: CLE27 protein n=1 Tax=Glycine max RepID=C6SX48_SOYBN	SoyBase	E_val: 2.00E-58	ISS
UniRef100_I1JBU5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBU5_SOYBN	SoyBase	E_val: 4.00E-67	ISS

Expression Patterns of Glyma02g02980

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g02980

Paralog	Evidence	Comments
Glyma01g04580	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g02980 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g025700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g02980

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g02980

Limit To All Plant Sequences

>Glyma02g02980.2   sequence type=CDS   gene model=Glyma02g02980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGTAGTAGTAGTAGTGGTAGTAGTAGTTCTTTCCCTCCAAGTTTCTTTAAAGCACTTCTTGTGGTGGGGCTTGTTTGTCTTCTTGTTTTGGGAAGCTTAGGTAGTGGTGAAGGAACAAGACATCCAACTACACAATGGTCTCAAGAAAGGGTCAAGCATGAACGAGTGGTTGGTAGAGATAAGCCTGTGGACAGTGCAGAATTGGATTTCAACTACATGAGCAAAAGAAGAGTTCCCAATGGACCAGATCCTATTCACAACAGGAGAGCTGGAAATTCTGGCCGACCCCCTGGCCAAGCTTAG

Predicted protein sequences of Glyma02g02980

Limit To All Plant Sequences

>Glyma02g02980.2   sequence type=predicted peptide   gene model=Glyma02g02980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGSSSSGSSSSFPPSFFKALLVVGLVCLLVLGSLGSGEGTRHPTTQWSQERVKHERVVGRDKPVDSAELDFNYMSKRRVPNGPDPIHNRRAGNSGRPPGQA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain