SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g02870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g02870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g02870

Feature Type:gene_model
Chromosome:Gm02
Start:2162647
stop:2164908
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10370AT Annotation by Michelle Graham. TAIR10: Glutathione S-transferase family protein | chr1:3397274-3398273 REVERSE LENGTH=227 SoyBaseE_val: 6.00E-33ISS
GO:0006749GO-bp Annotation by Michelle Graham. GO Biological Process: glutathione metabolic process SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009704GO-bp Annotation by Michelle Graham. GO Biological Process: de-etiolation SoyBaseN/AISS
GO:0015824GO-bp Annotation by Michelle Graham. GO Biological Process: proline transport SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0060416GO-bp Annotation by Michelle Graham. GO Biological Process: response to growth hormone stimulus SoyBaseN/AISS
GO:0080148GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of response to water deprivation SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004364GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity SoyBaseN/AISS
PTHR11260Panther GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING JGI ISS
PTHR11260:SF16Panther GLUTATHIONE S-TRANSFERASE THETA JGI ISS
PF02798PFAM Glutathione S-transferase, N-terminal domain JGI ISS
UniRef100_I1JBT4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JBT4_SOYBN SoyBaseE_val: 2.00E-56ISS
UniRef100_Q9FQF3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutathione S-transferase GST 5 n=1 Tax=Glycine max RepID=Q9FQF3_SOYBN SoyBaseE_val: 5.00E-44ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g02870 not represented in the dataset

Glyma02g02870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g02870.1   sequence type=CDS   gene model=Glyma02g02870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAAAAATGACTTGTGGCTTTTGGGTGCTTGGTTCAGTCCATTTGCCCTGAGGGTGCAGATTGCCCTTAACCTTAAGGGTTTAGATTATGAGGTTGTTGAAGAGACCTTAAATCCCAAAAGTGAGTTGCTTCTTAAGTCCAACCCTGTGCACAAGAAAATCCCAGTTTTCTTCCATGGAGATAAAGTTATATGTGAATCTGCAATCATAGTTGAGTACATTGATGAGGTTTGGTTCAACAATGCTCCCTCCCTCCTTCCATAA

>Glyma02g02870.1   sequence type=predicted peptide   gene model=Glyma02g02870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKNDLWLLGAWFSPFALRVQIALNLKGLDYEVVEETLNPKSELLLKSNPVHKKIPVFFHGDKVICESAIIVEYIDEVWFNNAPSLLP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo