SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02721

Feature Type:gene_model
Chromosome:Gm02
Start:2079358
stop:2080250
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g02721
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G35340AT Annotation by Michelle Graham. TAIR10: helicase domain-containing protein | chr2:14872728-14879615 FORWARD LENGTH=1044 SoyBaseE_val: 9.00E-135ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004004GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent RNA helicase activity SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
PTHR18934Panther ATP-DEPENDENT RNA HELICASE JGI ISS
PF04408PFAM Helicase associated domain (HA2) JGI ISS
PF07717PFAM Domain of unknown function (DUF1605) JGI ISS
UniRef100_F4IJV4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Helicase domain-containing protein n=1 Tax=Arabidopsis thaliana RepID=F4IJV4_ARATH SoyBaseE_val: 4.00E-132ISS
UniRef100_I1J5J2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J5J2_SOYBN SoyBaseE_val: 1.00E-152ISS

Expression Patterns of Glyma02g02721
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g02721 not represented in the dataset
Glyma02g02721 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g02721 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g023300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g02721
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g02721
>Glyma02g02721.1   sequence type=CDS   gene model=Glyma02g02721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGATAACACTGTACCCGAAATACAGCGGACTAACCTTGCAAATGTGGGTTTAACTTTAAAAAGTCTTGGTATTGACAATGTAATGCAGTTTGATTTTATGGATCCTCCACCTGATGAAGCCTTATTGAAAGCTCATGAGCTTCTATATGCATTAAGTTCATTGAATAAGTTTGGTGAGTTAACTAAGTACAAGTGTTCGGATGATATTATCTCTATTGCTGCTATGCTTTCTGTTGGGAAGTCAATATTCTACCGTCCAAAGGATAAACAGGTATACGCAGACAACGCAATGATGAATTTTCACACTGGAAATGTTGGAGACCATATTACATTACTAAGGGTCTACAATTCATGGAAGAAGACCAATTATTCAACGCAATGCATGAGACAGACTAGGGATATCCGTGATCAACTTGCAGGTCTTTTAGAGAGGGTTGAGATTGAACTAACTTCAAATTCTAGTGATGTAGATGCCATCAAGAAATCCATTACATCTGGGTTTTTCCCACACTCTGCGAGACTGCAAAAGTTTGGATTATATAAGACTATTAAACATTTACAGAATGTTCGCATACACCCTGGTTCGGGACTGGCGCAGGTTCTTCCTAGATGGGTTGTGTACCATGAACTAGTACTCACAACCAAGGAATATATGAGACAGGTGACGGAGATAAATCCAGAGTGGTTGGTGGAGATAGCCCCTCACTATTACCAGCTGAAGGATGTTGAAGATTCATATTCCAAGAAGATGCCTCGTGGAGCAGGACGTGCATATTTGGACAGATAG
Predicted protein sequences of Glyma02g02721
>Glyma02g02721.1   sequence type=predicted peptide   gene model=Glyma02g02721   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGDNTVPEIQRTNLANVGLTLKSLGIDNVMQFDFMDPPPDEALLKAHELLYALSSLNKFGELTKYKCSDDIISIAAMLSVGKSIFYRPKDKQVYADNAMMNFHTGNVGDHITLLRVYNSWKKTNYSTQCMRQTRDIRDQLAGLLERVEIELTSNSSDVDAIKKSITSGFFPHSARLQKFGLYKTIKHLQNVRIHPGSGLAQVLPRWVVYHELVLTTKEYMRQVTEINPEWLVEIAPHYYQLKDVEDSYSKKMPRGAGRAYLDR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo