SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02710

Feature Type:gene_model
Chromosome:Gm02
Start:2073904
stop:2074925
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g02710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G39950AT Annotation by Michelle Graham. TAIR10: thioredoxin 2 | chr5:15990885-15991881 REVERSE LENGTH=133 SoyBaseE_val: 3.00E-42ISS
GO:0000103GO-bp Annotation by Michelle Graham. GO Biological Process: sulfate assimilation SoyBaseN/AISS
GO:0000280GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear division SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006662GO-bp Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process SoyBaseN/AISS
GO:0007000GO-bp Annotation by Michelle Graham. GO Biological Process: nucleolus organization SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
GO:0016671GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor SoyBaseN/AISS
KOG0907 KOG Thioredoxin JGI ISS
PTHR10438Panther THIOREDOXIN-RELATED JGI ISS
PF00085PFAM Thioredoxin JGI ISS
UniRef100_I1JBS5UniRef Annotation by Michelle Graham. Best UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1JBS5_SOYBN SoyBaseE_val: 3.00E-89ISS
UniRef100_I1JBS5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin n=1 Tax=Glycine max RepID=I1JBS5_SOYBN SoyBaseE_val: 3.00E-89ISS

Expression Patterns of Glyma02g02710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g02710
ParalogEvidenceComments
Glyma01g04800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g02710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g023100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g02710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g02710
>Glyma02g02710.1   sequence type=CDS   gene model=Glyma02g02710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGCCAACTTATCCAACATGGAGAATGCTCATAAATCATCAAAGTCATCATCAGACCACATTCTCACCTTCCATTCCACTGCTAAATGGAAGACTCATTTTGATGCTTCCAAAGAAACTAACAAGTTGATGGTAATCGATTTCACGGCTACATGGTGTGGACCTTGCAAATCCATGGACCCAATTATCCAAGAGTATGCTGCAAAGTACACCAACGTGGAATTCATCAAAATTGATGTGGATGAGTTGATGGGGGTCTCTCAAGAATTCCAGGTGCATGCAATGCCAACATTCATATTGATAAAGAAAGGAAAAGTTGTTGATAAGGTGGTGGGTGCAAAAAAGGAAGAGCTGCAAAAGCTTATAGAGAAGCATCTAAACTGA
Predicted protein sequences of Glyma02g02710
>Glyma02g02710.1   sequence type=predicted peptide   gene model=Glyma02g02710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGANLSNMENAHKSSKSSSDHILTFHSTAKWKTHFDASKETNKLMVIDFTATWCGPCKSMDPIIQEYAAKYTNVEFIKIDVDELMGVSQEFQVHAMPTFILIKKGKVVDKVVGAKKEELQKLIEKHLN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo