SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g02640

Feature Type:gene_model
Chromosome:Gm02
Start:2011714
stop:2013846
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27050AT Annotation by Michelle Graham. TAIR10: homeobox protein 54 | chr1:9393706-9394408 FORWARD LENGTH=205 SoyBaseE_val: 1.00E-48ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_G7K9R0UniRef Annotation by Michelle Graham. Most informative UniRef hit: RCC1 and BTB domain-containing protein n=1 Tax=Medicago truncatula RepID=G7K9R0_MEDTR SoyBaseE_val: 4.00E-79ISS
UniRef100_I1JBR8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JBR8_SOYBN SoyBaseE_val: 1.00E-97ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma01g04880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g02640.1   sequence type=CDS   gene model=Glyma02g02640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCCTACCCCAGGACTGCTCCGTCCTCGATCTCAAGTCCCGATTCGAGATCTACGGGGCTATCTCCCGCATCCGCATCGACCGCGACGCCGTCGGCTACATCACCTACCGGACGAAGGACTCCGCCGACGCTTCTATCGCCGCCGACCTCGACCCCTCCTTCGGAATCACCGTTAACTCCAAAAAGGTTCGGGTGTTGTGGGCAACGGACCCTCTAGCCATGTGGAGGGAAGGAGTTGGTAATAGCAGGGACAAAAGCTCTATGTCAAAACTTGTGCGTGCTGAGGTACCCTTGAGCAAGCATGGAAGAGGTAATAGACTCTCTTCAGCCATAGGGAACACCAAACGTAGTGAGGATAGCTCAGGTAGCTCGGTTTTAGAAGTGCCTTTCAAGGGGAGAGAAATTGTTGCTTACGATGATATCCTCTAA

>Glyma02g02640.1   sequence type=predicted peptide   gene model=Glyma02g02640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLPQDCSVLDLKSRFEIYGAISRIRIDRDAVGYITYRTKDSADASIAADLDPSFGITVNSKKVRVLWATDPLAMWREGVGNSRDKSSMSKLVRAEVPLSKHGRGNRLSSAIGNTKRSEDSSGSSVLEVPFKGREIVAYDDIL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo