Glyma02g02540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02540

Feature Type:	gene_model
Chromosome:	Gm02
Start:	1876341
stop:	1879742
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g02540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62740	AT	Annotation by Michelle Graham. TAIR10: SPFH/Band 7/PHB domain-containing membrane-associated protein family \| chr5:25201320-25202535 FORWARD LENGTH=286	SoyBase	E_val: 0	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043424	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding	SoyBase	N/A	ISS
KOG2620	KOG	Prohibitins and stomatins of the PID superfamily	JGI		ISS
PTHR10264	Panther	STOMATIN-RELATED	JGI		ISS
PTHR10264:SF25	Panther	INTEGRAL MEMBRANE PROTEINASE	JGI		ISS
PF01145	PFAM	SPFH domain / Band 7 family	JGI		ISS
UniRef100_I1JBQ0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JBQ0_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q5KSB6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hypersensitive-induced response protein n=1 Tax=Lotus japonicus RepID=Q5KSB6_LOTJA	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma02g02540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g02540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g021400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g02540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g02540

Limit To All Plant Sequences

>Glyma02g02540.4   sequence type=CDS   gene model=Glyma02g02540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACAAGTGTTAGGTTGCGTGCAAGTGGATCAGTCAAGTTTGGCCATCAAGGAGGTTTTCGGGAAGTACGATGATGTTCTCGAACCTGGTTGCCACTGTGTTCCATGGTGTTTCGGCAGTCGTGTGGCTGGTGCTCTTTCTTTGCGTGTCAAACAGCTAGATGTTCGCTGTGAAACCAAGACTAAGGACAATGTCTTTGTGACTGTGGTTGCTTCTATCCAATATCGAGCATTGGCAGAAAAGGCAGTGGATGCTTACTACAAACTCAGCAATACCAGATCACAGATTCAGTCCTATGTCTTTGATGTTATCAGAGCAAGTGTTCCAAAGATGGAACTAGATGCTACTTTTGAGCAGAAGAATGAAATTGCAAAAGCAGTGGAGGAAGAACTTGAAAAGGCTATGTCAGCTTATGGGTATGAGATAGTTCAGACGCTTATTGTGGATATTGAGCCAGATGAGCATGTGAAGAGAGCCATGAATGAGATTAATGCTGCTGCAAGATTGAGGGTGGCTGCAAATGAGAAAGCTGAAGCAGAGAAGATATTGCAGATAAAGCGAGCAGAAGGGGATGCAGAATCAAAGTACCTAGCAGGCCTTGGGATTGCTCGTCAGCGCCAAGCCATAGTAGATGGCCTGAGGGACAGTGTGCTGGCTTTCTCTGAGAATGTTCCCGGGACAACATCAAAGGATATCATGGACATGGTTCTCATGACCCAATATTTTGACACAATGAAGGACATTGGTGCATCCTCCAAATCCAATGCTGTTTTCATTCCACATGGACCTGGTGCTGTACAAGACGTTGCTTCACAAATTAGGAATGGTCTTCTCCAAGGAAATGCAACACAGTCTTGA

Predicted protein sequences of Glyma02g02540

Limit To All Plant Sequences

>Glyma02g02540.4   sequence type=predicted peptide   gene model=Glyma02g02540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQVLGCVQVDQSSLAIKEVFGKYDDVLEPGCHCVPWCFGSRVAGALSLRVKQLDVRCETKTKDNVFVTVVASIQYRALAEKAVDAYYKLSNTRSQIQSYVFDVIRASVPKMELDATFEQKNEIAKAVEEELEKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRVAANEKAEAEKILQIKRAEGDAESKYLAGLGIARQRQAIVDGLRDSVLAFSENVPGTTSKDIMDMVLMTQYFDTMKDIGASSKSNAVFIPHGPGAVQDVASQIRNGLLQGNATQS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain