SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02510

Feature Type:gene_model
Chromosome:Gm02
Start:1870401
stop:1873913
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g02510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62740AT Annotation by Michelle Graham. TAIR10: SPFH/Band 7/PHB domain-containing membrane-associated protein family | chr5:25201320-25202535 FORWARD LENGTH=286 SoyBaseE_val: 4.00E-60ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043424GO-mf Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding SoyBaseN/AISS
PTHR10264Panther STOMATIN-RELATED JGI ISS
PTHR10264:SF25Panther INTEGRAL MEMBRANE PROTEINASE JGI ISS
UniRef100_Q5KSB6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hypersensitive-induced response protein n=1 Tax=Lotus japonicus RepID=Q5KSB6_LOTJA SoyBaseE_val: 8.00E-60ISS
UniRef100_UPI0002336C1DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336C1D related cluster n=1 Tax=unknown RepID=UPI0002336C1D SoyBaseE_val: 3.00E-91ISS

Expression Patterns of Glyma02g02510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g02510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g02510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g02510
>Glyma02g02510.1   sequence type=CDS   gene model=Glyma02g02510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACAAGTGTACGGTTGCTTTCAAGTGAAGCATTCAAGTGTAGCCATTAAGGAGGTTTTCGGGAAGTACGATGATGTTCTTGAACCAGGTTGCCACTTTGTTGCATGGTGTTTTGGGCGGCGTGTGGCTGGTGCACTTTCTTTACGTGTGAAACTAAGACTAAGTGTGGTTGCCTCAATCCAATATCGAGCATTGGCAGAAAAGGCAGCAGATGTTTACTACAAACTCACCAATACCAAAGCACAGATACAACCCTTATCTTATGGTTACGAGATAGTTCAGACTCTTATTGTGGATATTGAGCCAGATGAGGGTGTCAAGAAAGCCATGAATGAGATTAATGCTGCTTCAAGATTGAGGATGGCTGCCAACGAGAAAGCCGAAGTAAAGAAGATATTGCAGATAAAGCGAGCAGAAAAGATTGGAAATGAAATTGAAAGACCGGAGGATGATGATGCATTGCCAATCTGA
Predicted protein sequences of Glyma02g02510
>Glyma02g02510.1   sequence type=predicted peptide   gene model=Glyma02g02510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQVYGCFQVKHSSVAIKEVFGKYDDVLEPGCHFVAWCFGRRVAGALSLRVKLRLSVVASIQYRALAEKAADVYYKLTNTKAQIQPLSYGYEIVQTLIVDIEPDEGVKKAMNEINAASRLRMAANEKAEVKKILQIKRAEKIGNEIERPEDDDALPI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo