Glyma02g02400 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02400

Feature Type:	gene_model
Chromosome:	Gm02
Start:	1800196
stop:	1803656
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g02400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G14400	AT	Annotation by Michelle Graham. TAIR10: ubiquitin carrier protein 1 \| chr1:4927294-4928136 REVERSE LENGTH=152	SoyBase	E_val: 2.00E-107	ISS
GO:0006301	GO-bp	Annotation by Michelle Graham. GO Biological Process: postreplication repair	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0006605	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006661	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process	SoyBase	N/A	ISS
GO:0009910	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0016197	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosomal transport	SoyBase	N/A	ISS
GO:0033523	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone H2B ubiquitination	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0016881	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity	SoyBase	N/A	ISS
KOG0419	KOG	Ubiquitin-protein ligase	JGI		ISS
PTHR24067	Panther	UBIQUITIN-CONJUGATING ENZYME E2	JGI		ISS
PF00179	PFAM	Ubiquitin-conjugating enzyme	JGI		ISS
UniRef100_A9PBR0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone ubiquitination proteins group n=13 Tax=Spermatophyta RepID=A9PBR0_POPTR	SoyBase	E_val: 2.00E-106	ISS
UniRef100_C6SWF0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWF0_SOYBN	SoyBase	E_val: 1.00E-108	ISS

Expression Patterns of Glyma02g02400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g02400

Paralog	Evidence	Comments
Glyma01g05080	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g02400 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g020000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g02400

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma02g02400

Limit To All Plant Sequences

>Glyma02g02400.2   sequence type=transcript   gene model=Glyma02g02400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTTTTTAATTTTCATATACATATCATAGTACTAATAATAATAATGATGATGATAACAAGAAGAAGAATCTCTTTCTCTCAGTACTGATAAGCATGGAAGCACTTTTCAAATGATCAAATCAAATTCTCTGTTCACGTTCACATCTTTTATAACCCGTTCCATCTTTTGCTTTCTCCTGGGACTGCACCCTTCACTCACAAGTCACCAGTCTCTCTCTTAGGTTGTGACTTGTGAGGATGTCAACTCCTGCAAGGAAGAGACTCATGAGAGATTTCAAAAGATTGCAACTAGATCCTCCTGCTGGCATCAGTGGTGCTCCTCAAGACAATAATATTATGCTTTGGAATGCAGTTATCTTCGGACCGGATGACACCCCCTGGGATGGAGGCACATTTAAGTTAACACTTCAGTTCACCGAGGATTATCCTAATAAACCACCTACAGTGCGCTTTGTTTCTCAAATGTTTCATCCCAACATTTATGCAGATGGAAGCATATGTTTGGACATTTTACAAAATCAATGGAGCCCGATTTATGATGTTGCGGCGATACTTACCTCAATTCAGGTCATAGTGATTCTCTATATTTTGGTATTGCCTTAAGACTATTAATGTGAACACTAATTTGATTGTATCCCATCCCAAAATCTGTGTACCTTTCTTTTGATAGCAGCGATTCATTGGAGTCATCGTTATACTTGTGCGAAGTTATGAGGGTGTAGGAGCCTTTAGCTGCCTTGTCTGTTAAGACTGTGAAATAAGAAATATTGCCTTTCGATTAGTTTTGCATACTCACAACAGTTCAAGAGTGTATCATATGTAGATTCATGTGCAAGTGCCAGATTCGTGTGTCTACAATACACTTATCTGTCAGTTTTGGTCTTG

Coding sequences of Glyma02g02400

Limit To All Plant Sequences

>Glyma02g02400.1   sequence type=CDS   gene model=Glyma02g02400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAACTCCTGCAAGGAAGAGACTCATGAGAGATTTCAAAAGATTGCAACTAGATCCTCCTGCTGGCATCAGTGGTGCTCCTCAAGACAATAATATTATGCTTTGGAATGCAGTTATCTTCGGACCGGATGACACCCCCTGGGATGGAGGCACATTTAAGTTAACACTTCAGTTCACCGAGGATTATCCTAATAAACCACCTACAGTGCGCTTTGTTTCTCAAATGTTTCATCCCAACATTTATGCAGATGGAAGCATATGTTTGGACATTTTACAAAATCAATGGAGCCCGATTTATGATGTTGCGGCGATACTTACCTCAATTCAGAGCTTGCTTTGTGATCCAAACCCAAACTCTCCAGCGAATTCAGAAGCTGCTCGGATGTTTAGTGAAAACAAACGTGAATACAACAGAAGAGTACGAGATATTGTTGAGCAGAGTTGGACTGCTGATTAA

>Glyma02g02400.2   sequence type=CDS   gene model=Glyma02g02400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAACTCCTGCAAGGAAGAGACTCATGAGAGATTTCAAAAGATTGCAACTAGATCCTCCTGCTGGCATCAGTGGTGCTCCTCAAGACAATAATATTATGCTTTGGAATGCAGTTATCTTCGGACCGGATGACACCCCCTGGGATGGAGGCACATTTAAGTTAACACTTCAGTTCACCGAGGATTATCCTAATAAACCACCTACAGTGCGCTTTGTTTCTCAAATGTTTCATCCCAACATTTATGCAGATGGAAGCATATGTTTGGACATTTTACAAAATCAATGGAGCCCGATTTATGATGTTGCGGCGATACTTACCTCAATTCAGGTCATAGTGATTCTCTATATTTTGGTATTGCCTTAA

Predicted protein sequences of Glyma02g02400

Limit To All Plant Sequences

>Glyma02g02400.1   sequence type=predicted peptide   gene model=Glyma02g02400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTPARKRLMRDFKRLQLDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSQMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVRDIVEQSWTAD*

>Glyma02g02400.2   sequence type=predicted peptide   gene model=Glyma02g02400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTPARKRLMRDFKRLQLDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSQMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQVIVILYILVLP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain