Glyma02g02390 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02390

Feature Type:	gene_model
Chromosome:	Gm02
Start:	1792583
stop:	1797676
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g02390

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G14410	AT	Annotation by Michelle Graham. TAIR10: ssDNA-binding transcriptional regulator \| chr1:4929352-4930810 REVERSE LENGTH=263	SoyBase	E_val: 1.00E-69	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0032211	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of telomere maintenance via telomerase	SoyBase	N/A	ISS
GO:0005697	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: telomerase holoenzyme complex	SoyBase	N/A	ISS
GO:0009295	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleoid	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009508	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid chromosome	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003697	GO-mf	Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding	SoyBase	N/A	ISS
GO:0042162	GO-mf	Annotation by Michelle Graham. GO Molecular Function: telomeric DNA binding	SoyBase	N/A	ISS
PF08536	PFAM	Whirly transcription factor	JGI		ISS
UniRef100_I1JBN8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBN8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q9M9S3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: F14L17.18 protein n=1 Tax=Arabidopsis thaliana RepID=Q9M9S3_ARATH	SoyBase	E_val: 6.00E-67	ISS

Expression Patterns of Glyma02g02390

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g02390 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g019900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g02390

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g02390

Limit To All Plant Sequences

>Glyma02g02390.2   sequence type=CDS   gene model=Glyma02g02390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCAGATTCAGTCCATTACCTTGAAGCACCTCTCACTACCAACCCACACTTTCGTTCCTTCAAAGTTCAAAATTCCTTTGAACCGCAATTTTTCTTTAACACCCAGATTCACATTCTCTTCATCACTCTCTGTCAAATGCTACCACCCCAACCTCGTTCAACCCAAGCCATTCCCTCCACTGCCACAACGCCCTCCATTTGCAGAATTGCCGCAGCAAAGGGTGTACGTGGGTTACTCCGTTTACACGAAGAAGGGCATGCTCACCGTGATTCCTAGACCTCCGGAATTTGAATCGAAAAGTTCTGGGGCGTTCAAAGTGTCCAAGGAAGGTTATGTTGTGCTCCAGTTTGCTCCCTCAGTTGGTGCTGATGAGCCCATATATGATTGGAACCACAAGCAGACATTCTCACTATCAGTGAGTGAAATGGGAACTCTAATTATCCTTGGTGCAAGGGATTCTTGGGAATTTTCTCATGAGACTGTTAAGTTGAAAAGCAAAATTGATGTTAGAAAAGTTTTGAAGGTGGAGCCACTTCTGGATGCTACTGGCCACTTATTTAGCTTAAGGGTTCTGAAAAAGCCTGCGAACATGGAGGGAATTCAGAAAAGCATCTTTCTCCCTGTTACAAGGGCAGATCTAGAAGTTTTAAGGTCACTTTTCAATTATATCATGCCATACCTTCTAGGTTGGAATGCCTTTGGAAACTCCATAAAGCCAGAGGTATATAGTCAAGTGAATAGTACTAACCCCAGATATGGAGCAGACAATGAATGGAACAGATAG

Predicted protein sequences of Glyma02g02390

Limit To All Plant Sequences

>Glyma02g02390.2   sequence type=predicted peptide   gene model=Glyma02g02390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSQIQSITLKHLSLPTHTFVPSKFKIPLNRNFSLTPRFTFSSSLSVKCYHPNLVQPKPFPPLPQRPPFAELPQQRVYVGYSVYTKKGMLTVIPRPPEFESKSSGAFKVSKEGYVVLQFAPSVGADEPIYDWNHKQTFSLSVSEMGTLIILGARDSWEFSHETVKLKSKIDVRKVLKVEPLLDATGHLFSLRVLKKPANMEGIQKSIFLPVTRADLEVLRSLFNYIMPYLLGWNAFGNSIKPEVYSQVNSTNPRYGADNEWNR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain