Glyma02g02200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g02200

Feature Type:	gene_model
Chromosome:	Gm02
Start:	1578361
stop:	1579050
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g02200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G02440	AT	Annotation by Michelle Graham. TAIR10: F-box family protein \| chr4:1072555-1073565 FORWARD LENGTH=336	SoyBase	E_val: 7.00E-57	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009585	GO-bp	Annotation by Michelle Graham. GO Biological Process: red, far-red light phototransduction	SoyBase	N/A	ISS
GO:0010099	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of photomorphogenesis	SoyBase	N/A	ISS
GO:0032880	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein localization	SoyBase	N/A	ISS
GO:0042752	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm	SoyBase	N/A	ISS
GO:0048366	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf development	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
UniRef100_B9SAQ8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phytochrome A-associated F-box protein, putative n=1 Tax=Ricinus communis RepID=B9SAQ8_RICCO	SoyBase	E_val: 8.00E-61	ISS
UniRef100_UPI0002337038	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337038 related cluster n=1 Tax=unknown RepID=UPI0002337038	SoyBase	E_val: 3.00E-169	ISS

Expression Patterns of Glyma02g02200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g02200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g02200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g02200

Limit To All Plant Sequences

>Glyma02g02200.2   sequence type=CDS   gene model=Glyma02g02200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAAAGCGTTTTCGCAGCGCTAACAGACGACATCGTCCTCTCCATTCTGGCGAAGCTAGACGACGATCCACGACACTGGGCGCGCGCGGCGTGCGTCTCCACCCGATTCTCCACCCTCATTCGCCACTTCTGCTGGAAGACCAAATGCTCCCAAACCTTCCCCTCATCTCTCATCTCCTCCGATTCCCCCTCCACCTGGTCCTCCCTCCTCAAGCTCGCCGTTTGCTGCCCCGGCCTCCGCCACGCCGGCATCCCCGCCGACCGGAACGCCGCGAAACGGATGAACATCTGCCGGAATTCGCATTTGGCCGGCGGCTATCGGCATCTGAGGAGAGAACAGGGATGCAAACTTCTCGCGAGACAGTTCCGCGACGATAATTTGTTCCTCTGCGACTGGCCCGGCTGCGTGCACTCCTATCAGAGGCGCGACTACATGCTCTTCCGAGGGTTCTTCCATAACTTCAAAGCGAGCGGGGTTTGGAGAAGCATCAGCGACGAGAAGAGAAGGAAGATCGATGTCGAGTGCGCCTTCTGCACGTGCCAGCACACGTGGGACCTCCAATCCGCCTTCTGCCTCAGACGTGGCTTCGGCTACCATCTCGATGGGGAACCAGTTGTTCGAGCTTATGTCTGTGAGAACGGTCATGTCTCTGGGGCTTGGACCAATATACCCTTGTACTCTTAG

Predicted protein sequences of Glyma02g02200

Limit To All Plant Sequences

>Glyma02g02200.2   sequence type=predicted peptide   gene model=Glyma02g02200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEESVFAALTDDIVLSILAKLDDDPRHWARAACVSTRFSTLIRHFCWKTKCSQTFPSSLISSDSPSTWSSLLKLAVCCPGLRHAGIPADRNAAKRMNICRNSHLAGGYRHLRREQGCKLLARQFRDDNLFLCDWPGCVHSYQRRDYMLFRGFFHNFKASGVWRSISDEKRRKIDVECAFCTCQHTWDLQSAFCLRRGFGYHLDGEPVVRAYVCENGHVSGAWTNIPLYS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain