SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g01960

Feature Type:gene_model
Chromosome:Gm02
Start:1429084
stop:1430853
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g01960
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16770AT Annotation by Michelle Graham. TAIR10: ethylene-responsive element binding protein | chr3:5705784-5706768 FORWARD LENGTH=248 SoyBaseE_val: 2.00E-42ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0008219GO-bp Annotation by Michelle Graham. GO Biological Process: cell death SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_D9ICY5UniRef Annotation by Michelle Graham. Best UniRef hit: ERF protein n=1 Tax=Glycine max RepID=D9ICY5_SOYBN SoyBaseE_val: 0ISS
UniRef100_D9ICY5UniRef Annotation by Michelle Graham. Most informative UniRef hit: ERF protein n=1 Tax=Glycine max RepID=D9ICY5_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g01960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g01960
ParalogEvidenceComments
Glyma10g02080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g01960 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g016100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g01960
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g01960
>Glyma02g01960.1   sequence type=CDS   gene model=Glyma02g01960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTGGCGGTGCCATCATCGCTGACTTCATACCCCGCCGTGGAGGCCGCCGCCTCACGGCCTCCGAGCTCTGGCCAAACTCCTTCGCCAAAGACGATGACTTTGACTTGGATTACTCCCACATCGCTACCCAACAACCCTCCACTCTCAAAAGGTCCCAACCTCCCAAAGTTAGCGAGCAGGTTGAGAATAAGCCGGTGAAGAGGCAGAGGAAGAATCTCTACAGAGGGATTCGGCAGCGTCCGTGGGGCAAATGGGCCGCGGAGATTCGCGATCCTAGAAAAGGGGTTCGTGTCTGGTTGGGCACCTTTAACACCGCAGAAGAAGCCGCGAGAGCCTACGATCGTGAAGCTCGAAAAATCCGAGGCAAAAAGGCTAAGGTGAATTTCCCCAACGAGGACGACGAATATTCCATTCAAGCTCGTAATCCAATTCCACCCCTTCCTTTCGCTCCACAACACCCTCCCCTGTACCAGCAACAGTACCGTTGCGATCTCAACAATGCCCCTAAAAATCTCAACTTTGAGTTCGGTTACGACCTGAACCACGCGGAGGCGTTCCCATCCCGCGTGGACGCCGTCAACGCTGACTCGGTGGTTGTCTCCGTTGATGAAAATTCGGGGTCAGCGTCGGGTTCAGAGGGTGCTTATTCGACAACGGAGTTCATGGGGTCCGTTCAGAACGGGAACGGTTATTTGGGTGGCACGGTAATGGAGAAGAAGGAGAAAGAGACAGAGGTTATTGAAGCTGAAGAAGAAAAGAACAAAGTGCTGGAGCTTTCTGAGGAGCTGATGGCGTACGAAAATTACATGAAGTTTTATCAGATTCCGTACTATGATGGACAATCCACGACGAATAATGTTCAGGAAAGCTTGGTTGGGGATCTCTGGAGTTTCGATTAG
Predicted protein sequences of Glyma02g01960
>Glyma02g01960.1   sequence type=predicted peptide   gene model=Glyma02g01960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCGGAIIADFIPRRGGRRLTASELWPNSFAKDDDFDLDYSHIATQQPSTLKRSQPPKVSEQVENKPVKRQRKNLYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDREARKIRGKKAKVNFPNEDDEYSIQARNPIPPLPFAPQHPPLYQQQYRCDLNNAPKNLNFEFGYDLNHAEAFPSRVDAVNADSVVVSVDENSGSASGSEGAYSTTEFMGSVQNGNGYLGGTVMEKKEKETEVIEAEEEKNKVLELSEELMAYENYMKFYQIPYYDGQSTTNNVQESLVGDLWSFD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo