Report for Sequence Feature Glyma02g01860
Feature Type: gene_model
Chromosome: Gm02
Start: 1326656
stop: 1327784
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma02g01860
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G30620 AT
Annotation by Michelle Graham. TAIR10: winged-helix DNA-binding transcription factor family protein | chr2:13045360-13046267 FORWARD LENGTH=202
SoyBase E_val: 5.00E-26 ISS
GO:0006334 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleosome assembly
SoyBase N/A ISS
GO:0000786 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleosome
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005730 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleolus
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
PTHR11467 Panther
HISTONE H1/H5
JGI ISS
PF00538 PFAM
linker histone H1 and H5 family
JGI ISS
UniRef100_B9RNJ1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Histone h1/h5, putative n=1 Tax=Ricinus communis RepID=B9RNJ1_RICCO
SoyBase E_val: 2.00E-36 ISS
UniRef100_I1JBI7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBI7_SOYBN
SoyBase E_val: 3.00E-127 ISS
Expression Patterns of Glyma02g01860
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma02g01860
Paralog Evidence Comments
Glyma10g01940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma02g01860 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.02g015100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma02g01860
Coding sequences of Glyma02g01860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma02g01860.1 sequence type=CDS gene model=Glyma02g01860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCAAAAGCAAACGCAAAGAACAAATCCCCCTCCACCGAGCTCCACCCTCCTTACTTCGAGATGATTGCGGATGCGATATCGTCCTTGAAAGACCGCACGGGTTCGAGCCAGCCAGCGATAGCCAAGTTCATCGAGGACAAGCACAGCAAAGTGCTCCCTCCCAACTTCCGGAAACTTCTCTCCGTTCAGTTGAAGAAACTCGTCAAATCGGAGAAGCTTTACAAGGTCAAAAACTCTTACAAACTTTCTTCCGCCACGGACAAAGAGACCCAGAAGAATACCGAAACCGAGCCCAAACAGAAGGTTGAAAAGAAGAAGAAGAAGAAGAAGAAGGTGGGTGAGAAGATTAAGAGGCTGAGCCAAGTGAAGACACCCGAAACTCTGAAGAAGAAAGCACCCACCAAGAAGGACGCGGCGGCAACTAAGAAGAAATCTGCGTCGGCGGTGGAAGGTTCAGGAGGAGGGAAAGTGAAGTGTTTGAGTCAGGTGAAGACCCCTGAGGCCTTGAAGAAGAAGAAGCCCAATTTGACACCCAAACCTTCCAGGCCCAACAGGAATGCTAGGAAATGA
Predicted protein sequences of Glyma02g01860
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma02g01860.1 sequence type=predicted peptide gene model=Glyma02g01860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSKANAKNKSPSTELHPPYFEMIADAISSLKDRTGSSQPAIAKFIEDKHSKVLPPNFRKLLSVQLKKLVKSEKLYKVKNSYKLSSATDKETQKNTETEPKQKVEKKKKKKKKVGEKIKRLSQVKTPETLKKKAPTKKDAAATKKKSASAVEGSGGGKVKCLSQVKTPEALKKKKPNLTPKPSRPNRNARK*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
