SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g01800

Feature Type:gene_model
Chromosome:Gm02
Start:1299615
stop:1300400
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47480AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3511) | chr2:19484207-19484539 REVERSE LENGTH=110 SoyBaseE_val: 8.00E-17ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF12023PFAM Domain of unknown function (DUF3511) JGI ISS
UniRef100_I1JBI3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBI3_SOYBN SoyBaseE_val: 1.00E-62ISS
UniRef100_Q10MM9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10MM9_ORYSJ SoyBaseE_val: 1.00E-13ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g01870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g014500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g01800.1   sequence type=CDS   gene model=Glyma02g01800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTACGGGTCGGGTCAGCGTCAGGTTGAGATAATGAGCGGGAAAAGCTACGGCTGTAGTCAGAGCTACATGGCGGCGATTCCGAGTGAGGTGACTCGGGCGAGTCACAGCGGGGCAGCCACGGCGGCGAAGCCTTGGAGTTTCGGTGACCCGGAGTCAAAGCGGAGAAAGAGGATTGCGAAGTACAACGTTTACGCGGTTGAGGGAAAGGTTAAGGCCACGCTCCGGGATGGGATCCGATGGATCAAGCACACGTGTTCTCGGATCGTCCATGGATACTAG

>Glyma02g01800.1   sequence type=predicted peptide   gene model=Glyma02g01800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDYGSGQRQVEIMSGKSYGCSQSYMAAIPSEVTRASHSGAATAAKPWSFGDPESKRRKRIAKYNVYAVEGKVKATLRDGIRWIKHTCSRIVHGY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo