SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g01791

Feature Type:gene_model
Chromosome:Gm02
Start:1298196
stop:1299475
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g01791
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G61710AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT4G02160.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:24800045-24800512 FORWARD LENGTH=155 SoyBaseE_val: 1.00E-10ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI0002337A7FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337A7F related cluster n=1 Tax=unknown RepID=UPI0002337A7F SoyBaseE_val: 7.00E-154ISS

Expression Patterns of Glyma02g01791
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g01791 not represented in the dataset
Glyma02g01791 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g01791
ParalogEvidenceComments
Glyma10g01860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g01791 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g014400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g01791
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g01791
>Glyma02g01791.1   sequence type=CDS   gene model=Glyma02g01791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCAAAGGCTGAAAACTCTATGATCGTTAGCATTGACCAAAAAGCAATTATTACCCCTCACGAAGAACCTAATAATAACATCACTCGTTCTTCCCTCAAGAAGGGTAAGAGGCAGAAGAACTTCTTCAAGGTGGCGCTGTTCATGATGCGAGGGCGTTCTCGTAAATCCAAAATGCTCGCCGTGGATGACGAGTCCAAGAGCATATGGAGGAAGCTGGTGGGGTCCATGAGGCCATTGCACCTACAAAGCAACCAATCTCCATCGCATGATATTGATAATAATAATAATAATAATAACATTCCTCCTCATCAATCTAAAATGATGAAGATTACCTCGGCACCGTCTGAAAACGGCGACGATGGGTTTGATTCTGCATCGGAGTTCACATACTCGCCGTCTCCGGCTAGTAGTCGTTACGCCTCAGCCGTGGGGCTAAACGAAATGGTGCAGGAGGAGGAGGAAGAGGTTGCGAAGGAGAAGATTAATAATGATGATGGGGATGGGGATGAGATGATTGATGCCAAGGCTGAGGAGTTCATTGCTCAATTTTACCATCAAATGAGGTTGCAGAGTTTGGATGTCACGGATGATCATTACCAAGAGATAAGCATGAGGTCATTAGGCTTATGA
Predicted protein sequences of Glyma02g01791
>Glyma02g01791.1   sequence type=predicted peptide   gene model=Glyma02g01791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAKAENSMIVSIDQKAIITPHEEPNNNITRSSLKKGKRQKNFFKVALFMMRGRSRKSKMLAVDDESKSIWRKLVGSMRPLHLQSNQSPSHDIDNNNNNNNIPPHQSKMMKITSAPSENGDDGFDSASEFTYSPSPASSRYASAVGLNEMVQEEEEEVAKEKINNDDGDGDEMIDAKAEEFIAQFYHQMRLQSLDVTDDHYQEISMRSLGL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo