SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g01670

Feature Type:gene_model
Chromosome:Gm02
Start:1213654
stop:1217509
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G47440AT Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr2:19469912-19471660 FORWARD LENGTH=526 SoyBaseE_val: 5.00E-15ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
UniRef100_B9RNG2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RNG2_RICCO SoyBaseE_val: 1.00E-14ISS
UniRef100_I1L7Q6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7Q6_SOYBN SoyBaseE_val: 2.00E-25ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g01720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g01670.1   sequence type=CDS   gene model=Glyma02g01670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAGCACTGGTGGCTACCAACAGAAAGTAACTCACCCGGGAAAGCATGTTGCCACCTAGGCCTAATGGAAGACGCAATGGTCCTTCTCCAAACCGGCAAACGCCTAGCCACCGCCGCATTCCGCCGCGAGAGCGAGGAGGCTGCTGCCGAGAAGCAGAGGAAGAAGGTTCTAGAAGCTCAATTGATGAGTAATGAGAAATTGGAAGACAAGAAGTGCACCGTTTCATCGCCTTCGACGGCGAACCCCTCTGTTTATCAGGGGGTGTTTTGCCGCGATATTGCGGTGGTTGGGAACTTGCTTTCGCAATCGGGGTTCAACCGCTCCATTCCGGTGAAGTACGAGGCGATGAGCTGCTGA

>Glyma02g01670.1   sequence type=predicted peptide   gene model=Glyma02g01670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKHWWLPTESNSPGKACCHLGLMEDAMVLLQTGKRLATAAFRRESEEAAAEKQRKKVLEAQLMSNEKLEDKKCTVSSPSTANPSVYQGVFCRDIAVVGNLLSQSGFNRSIPVKYEAMSC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo