Glyma02g01670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g01670

Feature Type:	gene_model
Chromosome:	Gm02
Start:	1213654
stop:	1217509
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g01670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G47440	AT	Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein \| chr2:19469912-19471660 FORWARD LENGTH=526	SoyBase	E_val: 5.00E-15	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0031072	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding	SoyBase	N/A	ISS
UniRef100_B9RNG2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RNG2_RICCO	SoyBase	E_val: 1.00E-14	ISS
UniRef100_I1L7Q6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7Q6_SOYBN	SoyBase	E_val: 2.00E-25	ISS

Expression Patterns of Glyma02g01670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g01670

Paralog	Evidence	Comments
Glyma10g01720	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g01670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g01670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g01670

Limit To All Plant Sequences

>Glyma02g01670.1   sequence type=CDS   gene model=Glyma02g01670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAGCACTGGTGGCTACCAACAGAAAGTAACTCACCCGGGAAAGCATGTTGCCACCTAGGCCTAATGGAAGACGCAATGGTCCTTCTCCAAACCGGCAAACGCCTAGCCACCGCCGCATTCCGCCGCGAGAGCGAGGAGGCTGCTGCCGAGAAGCAGAGGAAGAAGGTTCTAGAAGCTCAATTGATGAGTAATGAGAAATTGGAAGACAAGAAGTGCACCGTTTCATCGCCTTCGACGGCGAACCCCTCTGTTTATCAGGGGGTGTTTTGCCGCGATATTGCGGTGGTTGGGAACTTGCTTTCGCAATCGGGGTTCAACCGCTCCATTCCGGTGAAGTACGAGGCGATGAGCTGCTGA

Predicted protein sequences of Glyma02g01670

Limit To All Plant Sequences

>Glyma02g01670.1   sequence type=predicted peptide   gene model=Glyma02g01670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKHWWLPTESNSPGKACCHLGLMEDAMVLLQTGKRLATAAFRRESEEAAAEKQRKKVLEAQLMSNEKLEDKKCTVSSPSTANPSVYQGVFCRDIAVVGNLLSQSGFNRSIPVKYEAMSC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain