Report for Sequence Feature Glyma02g01590
Feature Type: gene_model
Chromosome: Gm02
Start: 1124343
stop: 1125600
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma02g01590
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G10530 AT
Annotation by Michelle Graham. TAIR10: Concanavalin A-like lectin protein kinase family protein | chr5:3324978-3326933 REVERSE LENGTH=651
SoyBase E_val: 5.00E-26 ISS
GO:0006468 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein phosphorylation
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0004672 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase activity
SoyBase N/A ISS
GO:0004674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0016301 GO-mf
Annotation by Michelle Graham. GO Molecular Function: kinase activity
SoyBase N/A ISS
GO:0016772 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups
SoyBase N/A ISS
PF00139 PFAM
Legume lectin domain
JGI ISS
UniRef100_P05046 UniRef
Annotation by Michelle Graham. Best UniRef hit: Lectin n=3 Tax=Glycine max RepID=LEC_SOYBN
SoyBase E_val: 0 ISS
UniRef100_P05046 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Lectin n=3 Tax=Glycine max RepID=LEC_SOYBN
SoyBase E_val: 0 ISS
Proteins Associated with Glyma02g01590
Locus Gene Symbol Protein Name
Le1-1 Lectin 1 gene 1
Expression Patterns of Glyma02g01590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma02g01590
Paralog Evidence Comments
Glyma10g01620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma02g01590 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.02g012600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma02g01590
Coding sequences of Glyma02g01590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma02g01590.1 sequence type=CDS gene model=Glyma02g01590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTACTTCAAAGTTGAAAACCCAGAATGTGGTTGTATCTCTCTCCCTAACCTTAACCTTGGTACTGGTGCTACTGACCAGCAAGGCAAACTCAGCGGAAACTGTTTCTTTCAGCTGGAACAAGTTCGTGCCGAAGCAACCAAACATGATCCTCCAAGGAGACGCTATTGTGACCTCCTCGGGAAAGTTACAACTCAATAAGGTTGACGAAAACGGCACCCCAAAACCCTCGTCTCTTGGTCGCGCCCTCTACTCCACCCCCATCCACATTTGGGACAAAGAAACCGGTAGCGTTGCCAGCTTCGCCGCTTCCTTCAACTTCACCTTCTATGCCCCTGACACAAAAAGGCTTGCAGATGGGCTTGCCTTCTTTCTCGCACCAATTGACACTAAGCCACAAACACATGCAGGTTATCTTGGTCTTTTCAACGAAAACGAGTCTGGTGATCAAGTCGTCGCTGTTGAGTTTGACACTTTCCGGAACTCTTGGGATCCACCAAATCCACACATCGGAATTAACGTCAATTCTATCAGATCCATCAAAACGACGTCTTGGGATTTGGCCAACAATAAAGTAGCCAAGGTTCTCATTACCTATGATGCCTCCACCAGCCTCTTGGTTGCTTCTTTGGTCTACCCTTCACAGAGAACCAGCAATATCCTCTCCGATGTGGTCGATTTGAAGACTTCTCTTCCCGAGTGGGTGAGGATAGGGTTCTCTGCTGCCACGGGACTCGACATACCTGGGGAATCGCATGACGTGCTTTCTTGGTCTTTTGCTTCCAATTTGCCACACGCTAGCAGTAACATTGATCCTTTGGATCTTACAAGCTTTGTGTTGCATGAGGCCATCTAA
Predicted protein sequences of Glyma02g01590
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma02g01590.1 sequence type=predicted peptide gene model=Glyma02g01590 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MATSKLKTQNVVVSLSLTLTLVLVLLTSKANSAETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPHASSNIDPLDLTSFVLHEAI*