SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g01500

Feature Type:gene_model
Chromosome:Gm02
Start:1076788
stop:1079079
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g01500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13400AT Annotation by Michelle Graham. TAIR10: Major facilitator superfamily protein | chr5:4296854-4299079 REVERSE LENGTH=624 SoyBaseE_val: 3.00E-22ISS
GO:0006857GO-bp Annotation by Michelle Graham. GO Biological Process: oligopeptide transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
UniRef100_G7KXR0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptide transporter-like protein n=1 Tax=Medicago truncatula RepID=G7KXR0_MEDTR SoyBaseE_val: 2.00E-22ISS
UniRef100_UPI000233F41BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F41B related cluster n=1 Tax=unknown RepID=UPI000233F41B SoyBaseE_val: 1.00E-25ISS

Expression Patterns of Glyma02g01500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g01500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g011600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g01500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g01500
>Glyma02g01500.1   sequence type=CDS   gene model=Glyma02g01500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATTGGTGGCCTTTATTTCTTAGGAATATCACAAGTTTCCTCCGTGCTCGATGGTTTTCTAGTCGATGCATATCTTGGACACTATTGGACCATAGCCATCTTCACTACAATCTATCTTGCGATATGATAATGTTATTTAAAAAAAATGAAATTTATCTAATTTTATATAAAATATCTAGCATGGTCTTCTTCATAGGCACTCCATTGTACAGGCACAGGTTGTTAGGAGGTAGCTCTCTTACTCGTGTTGCTCAAGTCTTGGTTGCTACATTTAGAAAGAGAAAGGCCTCTTTTGGTAGCAATGAGTTCATAGGCTTGTATGAGGTTCCTGTTAGGCAGTCTGTTATCAAGGGAAGTGTGAGAAATTTGTCTTTATATGTTCATATCAATTACTTTATATTTGATTATAAAACAGTTGAATCCATTCCCATTCATTTTATATATCAGGTAGTTTTCCAATTGACTGATACTAATGAACTGTCGCTTTTGGAGTGTACAGTACGTGCTGATTTACTTGTTTTAGTATCTGGGATATTGCTGGGAAAATGTAAGTTGTTAATTTGTGTCTTGCAAGTATGTTTCTGGACCTATTTTGAGATGAATAAGCCATTCATATGA
Predicted protein sequences of Glyma02g01500
>Glyma02g01500.1   sequence type=predicted peptide   gene model=Glyma02g01500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYWWPLFLRNITSFLRARWFSSRCISWTLLDHSHLHYNLSCDMIMLFKKNEIYLILYKISSMVFFIGTPLYRHRLLGGSSLTRVAQVLVATFRKRKASFGSNEFIGLYEVPVRQSVIKGSVRNLSLYVHINYFIFDYKTVESIPIHFIYQVVFQLTDTNELSLLECTVRADLLVLVSGILLGKCKLLICVLQVCFWTYFEMNKPFI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo