SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g01490

Feature Type:gene_model
Chromosome:Gm02
Start:1073745
stop:1074670
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G02550AT Annotation by Michelle Graham. TAIR10: Plant invertase/pectin methylesterase inhibitor superfamily protein | chr1:536483-537211 FORWARD LENGTH=242 SoyBaseE_val: 1.00E-11ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004857GO-mf Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity SoyBaseN/AISS
GO:0030599GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity SoyBaseN/AISS
GO:0046910GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity SoyBaseN/AISS
PF04043PFAM Plant invertase/pectin methylesterase inhibitor JGI ISS
UniRef100_G7ICW8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pectinesterase inhibitor n=1 Tax=Medicago truncatula RepID=G7ICW8_MEDTR SoyBaseE_val: 2.00E-57ISS
UniRef100_I1JBF5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JBF5_SOYBN SoyBaseE_val: 8.00E-156ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g01530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g011500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g01490.1   sequence type=CDS   gene model=Glyma02g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCACTTGAGATTCAACAAAACCACCCTTGTCCTCATCGGAACCCTCTCTTGCCTCCTCCTGTCCATCACTGCCGTCCCCTCAACTCGCGTCTTGGAACTCGCTCCCAGCGAAGCCCCCACCGCGGAGCCTATAGCCTCCGGCATCAGCCTCTTCGACAATCTTCTTGCCAAGGAATCAAGCCCCATGATTCTGAAATTCTGCACCGGCACCGAGAACCCCACCCTCTGCGCCGAAACCATTGCACCATACCTAACCGGCACATTCGACCCGATCCAGGCGCTAGAGACCGAGATCAACGCGACCCTGGAGAAGGCGGAGGAGATCGCCGGCAACATCAAGAAGATGCTAGACGACCCGACCACGACGAAGAACGCCATGGACGCGTTGGGCATCTGCCAGTCGCAGTACGATAACATTCTAGATAACATAAAGGAGACTGTGGAGTTGGTGGGGAACCAGAACGTGGTGGATGCTTGGTACAGGTTCAGCTCTGTCCTTTCGTACAAAGAAGCATGCGAGGATGCTTTCAAAGAGTCTCCCGGGGTCGACATGCCCTTCCCTGAAGATAACACCAAGCTGTTCCAGTTGAGCGGCAATTGCCTCGCCGTCATGGACGGCATTGTTAACAATCACAAGATGTAA

>Glyma02g01490.1   sequence type=predicted peptide   gene model=Glyma02g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDHLRFNKTTLVLIGTLSCLLLSITAVPSTRVLELAPSEAPTAEPIASGISLFDNLLAKESSPMILKFCTGTENPTLCAETIAPYLTGTFDPIQALETEINATLEKAEEIAGNIKKMLDDPTTTKNAMDALGICQSQYDNILDNIKETVELVGNQNVVDAWYRFSSVLSYKEACEDAFKESPGVDMPFPEDNTKLFQLSGNCLAVMDGIVNNHKM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo