Glyma02g01310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g01310

Feature Type:	gene_model
Chromosome:	Gm02
Start:	952310
stop:	953528
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g01310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G19730	AT	Annotation by Michelle Graham. TAIR10: Pectin lyase-like superfamily protein \| chr5:6670562-6673202 FORWARD LENGTH=383	SoyBase	E_val: 6.00E-53	ISS
GO:0009411	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV	SoyBase	N/A	ISS
GO:0009813	GO-bp	Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0042545	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall modification	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0030599	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity	SoyBase	N/A	ISS
PF01095	PFAM	Pectinesterase	JGI		ISS
UniRef100_B9I9F4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pectinesterase (Fragment) n=1 Tax=Populus trichocarpa RepID=B9I9F4_POPTR	SoyBase	E_val: 3.00E-74	ISS
UniRef100_I1JBD5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JBD5_SOYBN	SoyBase	E_val: 5.00E-97	ISS

Expression Patterns of Glyma02g01310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g01310

Paralog	Evidence	Comments
Glyma10g01355	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g01310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g01310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g01310

Limit To All Plant Sequences

>Glyma02g01310.2   sequence type=CDS   gene model=Glyma02g01310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACAAAGAATAATTTTGTGGGAAGAGGATGCTAAATCATTGTGTGCTAAAACAGAACAGTGCTCCGCATGTGGTTGGAAGGAGGGGGGAACAAGCCGTGGCGCTTCGCATGATCGCATCTCAGGAACCAAAGCTGGTTTCTATGGAACTCAAGACACTCTCTATGATCACAAAGGCCTTCATTACTTCAACAACTGCTCTATTCAAGGTTCTGTTCTTTTCATCTTCGGTTCCGCCAGGTCCCTTTACGAGAATTGCTATCTAAATTCCACAACCAAGAAGATTTATCTTGGAAGAGCATGGGGAGATTATTCCAGAGTTATTTTCTCATACACCTACATGGACAACATAGTTCTCCCCAAAGGATGGAGTGATTGGGGTGACCAAAAGCGTGACTCGAGAGTATATTATGGAGAATACAAGTGTAGTGGGCCAGGAGCTAACTTGGCTGGAAGTGTGCCATGGGCACGGGTACTGACGGATGAAGAGGCCAAGCCTTTTATTGGAATGCAATTCATTGAACGGGACACTTGGCTTGCTAGCCCCTAA

Predicted protein sequences of Glyma02g01310

Limit To All Plant Sequences

>Glyma02g01310.2   sequence type=predicted peptide   gene model=Glyma02g01310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQRIILWEEDAKSLCAKTEQCSACGWKEGGTSRGASHDRISGTKAGFYGTQDTLYDHKGLHYFNNCSIQGSVLFIFGSARSLYENCYLNSTTKKIYLGRAWGDYSRVIFSYTYMDNIVLPKGWSDWGDQKRDSRVYYGEYKCSGPGANLAGSVPWARVLTDEEAKPFIGMQFIERDTWLASP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain