SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g01200

Feature Type:gene_model
Chromosome:Gm02
Start:889034
stop:893057
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G02475AT Annotation by Michelle Graham. TAIR10: Polyketide cyclase/dehydrase and lipid transport superfamily protein | chr1:514110-515331 REVERSE LENGTH=219 SoyBaseE_val: 3.00E-52ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03364PFAM Polyketide cyclase / dehydrase and lipid transport JGI ISS
UniRef100_B6T2Z5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cyclase/dehydrase n=1 Tax=Zea mays RepID=B6T2Z5_MAIZE SoyBaseE_val: 1.00E-53ISS
UniRef100_UPI0001BA939FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001BA939F related cluster n=1 Tax=unknown RepID=UPI0001BA939F SoyBaseE_val: 1.00E-111ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g01260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g009000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g01200.2   sequence type=CDS   gene model=Glyma02g01200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTATTACAACAACACAAGCTTTGACCCCCTTGTCGTCATCACGTAAAAGTAGAAGTAGAACCACATTTGGCGCCAATTCCACCTCCACAAGCTTCCCCGCTACTCCACTCTCCTCCAATCTCCTCCTCTTCAAGCTCAGTCACACTTCTTCCAAACGAACCTCAACCACCTTCCATGCCTTCAAGCGCTTTTCCCCCGTCATGGAGTGGCAGGATTGCACGGTTAAGATGGAGATTGATGTGCCCATCTCTGTAGCCTATACTTGTTATTCTGATCGCGAAGCCATCCCAAACTGGATGCCCTTTATTTCTTCTGTTAAGATATTGCCAGACAAACCTGACCTGTCACGATGGTCCTTGAAGTATAAGGCATTTGGTCGTGATATTGAATTCTCTTGGCTTGCTCCCCATTCCAAATCAGAAAATCCACTGGCGATCTATGGAAGGTCTTCAAAACAGCTGACAGTCTCATATGAGGTTCCTCAACTTTTAGCTCCAGTGGCATCGGCACTGCAACCTTTCCTTGAAGGTTTACTTACACGTGGTTTGGAAAGATTTGCTACATTCGCCAAAAGCTACACCTAA

>Glyma02g01200.2   sequence type=predicted peptide   gene model=Glyma02g01200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSITTTQALTPLSSSRKSRSRTTFGANSTSTSFPATPLSSNLLLFKLSHTSSKRTSTTFHAFKRFSPVMEWQDCTVKMEIDVPISVAYTCYSDREAIPNWMPFISSVKILPDKPDLSRWSLKYKAFGRDIEFSWLAPHSKSENPLAIYGRSSKQLTVSYEVPQLLAPVASALQPFLEGLLTRGLERFATFAKSYT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo