Glyma02g01200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g01200

Feature Type:	gene_model
Chromosome:	Gm02
Start:	889034
stop:	893057
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g01200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G02475	AT	Annotation by Michelle Graham. TAIR10: Polyketide cyclase/dehydrase and lipid transport superfamily protein \| chr1:514110-515331 REVERSE LENGTH=219	SoyBase	E_val: 3.00E-52	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03364	PFAM	Polyketide cyclase / dehydrase and lipid transport	JGI		ISS
UniRef100_B6T2Z5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cyclase/dehydrase n=1 Tax=Zea mays RepID=B6T2Z5_MAIZE	SoyBase	E_val: 1.00E-53	ISS
UniRef100_UPI0001BA939F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0001BA939F related cluster n=1 Tax=unknown RepID=UPI0001BA939F	SoyBase	E_val: 1.00E-111	ISS

Expression Patterns of Glyma02g01200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g01200

Paralog	Evidence	Comments
Glyma10g01260	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g01200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g009000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g01200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g01200

Limit To All Plant Sequences

>Glyma02g01200.2   sequence type=CDS   gene model=Glyma02g01200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTATTACAACAACACAAGCTTTGACCCCCTTGTCGTCATCACGTAAAAGTAGAAGTAGAACCACATTTGGCGCCAATTCCACCTCCACAAGCTTCCCCGCTACTCCACTCTCCTCCAATCTCCTCCTCTTCAAGCTCAGTCACACTTCTTCCAAACGAACCTCAACCACCTTCCATGCCTTCAAGCGCTTTTCCCCCGTCATGGAGTGGCAGGATTGCACGGTTAAGATGGAGATTGATGTGCCCATCTCTGTAGCCTATACTTGTTATTCTGATCGCGAAGCCATCCCAAACTGGATGCCCTTTATTTCTTCTGTTAAGATATTGCCAGACAAACCTGACCTGTCACGATGGTCCTTGAAGTATAAGGCATTTGGTCGTGATATTGAATTCTCTTGGCTTGCTCCCCATTCCAAATCAGAAAATCCACTGGCGATCTATGGAAGGTCTTCAAAACAGCTGACAGTCTCATATGAGGTTCCTCAACTTTTAGCTCCAGTGGCATCGGCACTGCAACCTTTCCTTGAAGGTTTACTTACACGTGGTTTGGAAAGATTTGCTACATTCGCCAAAAGCTACACCTAA

Predicted protein sequences of Glyma02g01200

Limit To All Plant Sequences

>Glyma02g01200.2   sequence type=predicted peptide   gene model=Glyma02g01200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSITTTQALTPLSSSRKSRSRTTFGANSTSTSFPATPLSSNLLLFKLSHTSSKRTSTTFHAFKRFSPVMEWQDCTVKMEIDVPISVAYTCYSDREAIPNWMPFISSVKILPDKPDLSRWSLKYKAFGRDIEFSWLAPHSKSENPLAIYGRSSKQLTVSYEVPQLLAPVASALQPFLEGLLTRGLERFATFAKSYT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain