SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g00981): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g00981): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g00981

Feature Type:gene_model
Chromosome:Gm02
Start:743645
stop:745595
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09530AT Annotation by Michelle Graham. TAIR10: phytochrome interacting factor 3 | chr1:3077216-3079367 FORWARD LENGTH=524 SoyBaseE_val: 2.00E-16ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009639GO-bp Annotation by Michelle Graham. GO Biological Process: response to red or far red light SoyBaseN/AISS
GO:0009704GO-bp Annotation by Michelle Graham. GO Biological Process: de-etiolation SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0010017GO-bp Annotation by Michelle Graham. GO Biological Process: red or far-red light signaling pathway SoyBaseN/AISS
GO:0031539GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of anthocyanin metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PTHR12565Panther STEROL REGULATORY ELEMENT-BINDING PROTEIN JGI ISS
PTHR12565:SF7Panther CENTROMERE-BINDING PROTEIN 1, CBP-1 JGI ISS
UniRef100_G7KUN6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor SPATULA n=1 Tax=Medicago truncatula RepID=G7KUN6_MEDTR SoyBaseE_val: 8.00E-27ISS
UniRef100_I1JB99UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JB99_SOYBN SoyBaseE_val: 1.00E-113ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g00981 not represented in the dataset

Glyma02g00981 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g007000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g00981.1   sequence type=CDS   gene model=Glyma02g00981   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGTATATTGAAGGAGCTCATACCCAATTGCAATAAGACGGACAAAGCATCAATGCTTGATGATGCCATCGAATATCTTAAGACCCTAAAGCTTCAGATACAGATGATGTCAATGGATGCTGGATTTTGTATACCTTTTATGATGCTACGTAATGCTGCTCATCATATGATGAACACACCCCTTTTACATCAGTTAATGGGACTTGGAATGGGGTTCAGGCCAGACACAGCCATACCTTGTAGCCTCCCTCAGTTCCCTATTACACCTTTGCCTGCCATCACTGACAACAGAGTTCACTTTTTTGGTTTCCCTAACCAAGTGCCACCCATGCCAATTTCTCATGCACCTTTCATTCCAATGCTTGGAAATCCTTCTACACAAACCCCTCTTGCAACTAGCACAGCTATCAACCTGGCAGAAAACCCTGCTTCTTCCCAGTTAACAACTCTAATGGCCTCAGTCCCCAAGAACTTGTATCTAAGTGGGCAATCTGAATATGCAACAAAGCAAGCACCGAGTCAAGTTTCCCTTCACCACTAG

>Glyma02g00981.1   sequence type=predicted peptide   gene model=Glyma02g00981   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRILKELIPNCNKTDKASMLDDAIEYLKTLKLQIQMMSMDAGFCIPFMMLRNAAHHMMNTPLLHQLMGLGMGFRPDTAIPCSLPQFPITPLPAITDNRVHFFGFPNQVPPMPISHAPFIPMLGNPSTQTPLATSTAINLAENPASSQLTTLMASVPKNLYLSGQSEYATKQAPSQVSLHH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo