SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g00870

Feature Type:gene_model
Chromosome:Gm02
Start:669869
stop:671254
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g00870
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23240AT Annotation by Michelle Graham. TAIR10: ethylene response factor 1 | chr3:8295705-8296361 FORWARD LENGTH=218 SoyBaseE_val: 7.00E-66ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7I5D9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7I5D9_MEDTR SoyBaseE_val: 6.00E-69ISS
UniRef100_I1JB91UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JB91_SOYBN SoyBaseE_val: 1.00E-148ISS

Expression Patterns of Glyma02g00870
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g00870
ParalogEvidenceComments
Glyma10g00980 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g00870 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g006200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g00870
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g00870
>Glyma02g00870.1   sequence type=CDS   gene model=Glyma02g00870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTGTTCCTCCGTTCTCCACTCATCAAACTCCTCATTCTTCCCCTTCAACGAAAACGACCCCGAAGAGATGCTCCTCTACGGCATGATCACGTCATACCAAGAAAAAGTGATCATCAAAGAAGAGGAAGTGAACTCAGAGGAAAACAACAACAAGAATAAGAAAAACAACAACAAGAGCAGCTTCCGCGGCGTGCGGAGTCGCCCGTGGGGGAAGTTCGCGGCGGAGATAAGGGACTCCACGCGGCACGGCGTGAGGGTGTGGCTTGGGACATTCGACAGCGCCGAGGCCGCGGCGCTGGCCTATGACCAAGCCGCGTTCTCCATGAGGGGCTCCGCCGCGGTGCTCAACTTCCCCGTGGAGAAGGTGAAGGAGTCATTAAGAGACATGAATTGCACTCTCTCTCAGCTTGATGGGTCTTCTCCCGTCGTGGCCTTGAAGAGGAGACACTCCTTAGGACGCAAAATGGCTGCTAAGAAGAAGAAGGTGGAAGAGACTCATGGTGATGTTCGGTTAGAGAATGTGGTTGTGTTGGAAGACCTAGGGGCTGAGTATTTGGAACACTTGTTGATGATGTCCTCTCATGATACTACTAGTTGTTCTTGGTGA
Predicted protein sequences of Glyma02g00870
>Glyma02g00870.1   sequence type=predicted peptide   gene model=Glyma02g00870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDCSSVLHSSNSSFFPFNENDPEEMLLYGMITSYQEKVIIKEEEVNSEENNNKNKKNNNKSSFRGVRSRPWGKFAAEIRDSTRHGVRVWLGTFDSAEAAALAYDQAAFSMRGSAAVLNFPVEKVKESLRDMNCTLSQLDGSSPVVALKRRHSLGRKMAAKKKKVEETHGDVRLENVVVLEDLGAEYLEHLLMMSSHDTTSCSW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo