SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g00770

Feature Type:gene_model
Chromosome:Gm02
Start:570901
stop:572012
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g00770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43860AT Annotation by Michelle Graham. TAIR10: chlorophyllase 2 | chr5:17630492-17632184 FORWARD LENGTH=318 SoyBaseE_val: 4.00E-33ISS
GO:0015996GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll catabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0043231GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular membrane-bounded organelle SoyBaseN/AISS
GO:0047746GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyllase activity SoyBaseN/AISS
PF07224PFAM Chlorophyllase JGI ISS
UniRef100_A1IGR4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyllase 3 n=1 Tax=Glycine max RepID=A1IGR4_SOYBN SoyBaseE_val: 4.00E-53ISS
UniRef100_UPI000233796CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233796C related cluster n=1 Tax=unknown RepID=UPI000233796C SoyBaseE_val: 4.00E-74ISS

Expression Patterns of Glyma02g00770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g00770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g00770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g00770
>Glyma02g00770.1   sequence type=CDS   gene model=Glyma02g00770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAATCCAATCATTATTTACCACATCTAAAAACTCCAACACCCCCCTTGTTTCTCACCTATGTTCCTAACTCATTTGATTTTGATATGGCAGTGATGGTCATAGGTTCAGATTTAGGTGAAGTGAAAAGGAATCCTTTGTTTCCTCCTTGTGCTCCTAAGGGTGTCAGCTATGAAAACTTCTTCAAGGAGTATGATGACACTATTAGGAGATCAACGCTCTCACAAATAAAATTACTCATACCCATAATGGATGATGAGAACACAACAAAGATTATACTTTCGACACCTCTTGTCTACGTCCACGGACCGTCTCAAAAAGGAGAAAGCTACCTATTGTCTATGAAAAATGGAGAGTTAAGGAAACCTATGAGAAGGTTTGTTGGAGGAGTCATTCTTGCATTCTTGAAAGCTTACTTGCATGATGATAATGAGGACTTGTTGGCCATAAGAGACAGGCATGTGAGTCTACCGGTGGAGATCCAATTTGATTCTTTTGTGTGA
Predicted protein sequences of Glyma02g00770
>Glyma02g00770.1   sequence type=predicted peptide   gene model=Glyma02g00770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSNHYLPHLKTPTPPLFLTYVPNSFDFDMAVMVIGSDLGEVKRNPLFPPCAPKGVSYENFFKEYDDTIRRSTLSQIKLLIPIMDDENTTKIILSTPLVYVHGPSQKGESYLLSMKNGELRKPMRRFVGGVILAFLKAYLHDDNEDLLAIRDRHVSLPVEIQFDSFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo