Glyma02g00670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g00670

Feature Type:	gene_model
Chromosome:	Gm02
Start:	458315
stop:	465146
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g00670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G33470	AT	Annotation by Michelle Graham. TAIR10: glycolipid transfer protein 1 \| chr2:14176599-14177950 REVERSE LENGTH=202	SoyBase	E_val: 6.00E-115	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0046836	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolipid transport	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0017089	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glycolipid transporter activity	SoyBase	N/A	ISS
GO:0051861	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glycolipid binding	SoyBase	N/A	ISS
KOG3221	KOG	Glycolipid transfer protein	JGI		ISS
PTHR10219	Panther	GLYCOLIPID TRANSFER PROTEIN-RELATED	JGI		ISS
PF08718	PFAM	Glycolipid transfer protein (GLTP)	JGI		ISS
UniRef100_C6T3E3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3E3_SOYBN	SoyBase	E_val: 1.00E-148	ISS
UniRef100_G7IR36	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pleckstrin homology domain-containing family A member n=2 Tax=Medicago truncatula RepID=G7IR36_MEDTR	SoyBase	E_val: 6.00E-130	ISS

Expression Patterns of Glyma02g00670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g00670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g004000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g00670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g00670

Limit To All Plant Sequences

>Glyma02g00670.1   sequence type=CDS   gene model=Glyma02g00670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGGACTGTCTTCACTCCTGCACTGCAAGAAATTGAGCATGTAAAGTCTGATCAAGGAGAAATTCTGAGCAAGCCTTTCTTGGATGCGTGCAAACACATATTGCCTGTAATAGATAAGTTTGGAGCTGCTATGGCCCTTGTTAAATCTGACATAGGTGGTAACATATCGAGATTGGAAACTATGTATTCTTCCAATCCAACCAGATTTAACTACCTGTACAGTTTGGTACAGGTAGAGGTTGAAACTAAAACAGCTAAATCATCATCCAGTTGTACCAATGGACTTCTTTGGCTCACAAGAGCAATGGATTTCTTGGTGGCTTTGTTCCGAAACTTAATCGAGCATGAAGATTGGCCAATGTCACAAGCATGTACAGATTCGTATAACAAGACTCTGAAGAAGTGGCATGGCTGGCTTGCTAGTTCAAGCTTCACAGTAGTCATGAAGCTTGCTCCTGATAGGAAGAAGTTTATGGACGTGATAGGAGGCACTGGCAATATCAGTGCTGACATTGAGAAATTTTGTACAACCTTTTCTCCTCTCCTTGAAGAGAATCACAAGTTTTTGGCTCGATTTGGCTTAGATGATATGAAGGCATCATGA

Predicted protein sequences of Glyma02g00670

Limit To All Plant Sequences

>Glyma02g00670.1   sequence type=predicted peptide   gene model=Glyma02g00670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGTVFTPALQEIEHVKSDQGEILSKPFLDACKHILPVIDKFGAAMALVKSDIGGNISRLETMYSSNPTRFNYLYSLVQVEVETKTAKSSSSCTNGLLWLTRAMDFLVALFRNLIEHEDWPMSQACTDSYNKTLKKWHGWLASSSFTVVMKLAPDRKKFMDVIGGTGNISADIEKFCTTFSPLLEENHKFLARFGLDDMKAS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain