SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g00670

Feature Type:gene_model
Chromosome:Gm02
Start:458315
stop:465146
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G33470AT Annotation by Michelle Graham. TAIR10: glycolipid transfer protein 1 | chr2:14176599-14177950 REVERSE LENGTH=202 SoyBaseE_val: 6.00E-115ISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046836GO-bp Annotation by Michelle Graham. GO Biological Process: glycolipid transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0017089GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolipid transporter activity SoyBaseN/AISS
GO:0051861GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolipid binding SoyBaseN/AISS
KOG3221 KOG Glycolipid transfer protein JGI ISS
PTHR10219Panther GLYCOLIPID TRANSFER PROTEIN-RELATED JGI ISS
PF08718PFAM Glycolipid transfer protein (GLTP) JGI ISS
UniRef100_C6T3E3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3E3_SOYBN SoyBaseE_val: 1.00E-148ISS
UniRef100_G7IR36UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pleckstrin homology domain-containing family A member n=2 Tax=Medicago truncatula RepID=G7IR36_MEDTR SoyBaseE_val: 6.00E-130ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g004000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g00670.1   sequence type=CDS   gene model=Glyma02g00670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGGACTGTCTTCACTCCTGCACTGCAAGAAATTGAGCATGTAAAGTCTGATCAAGGAGAAATTCTGAGCAAGCCTTTCTTGGATGCGTGCAAACACATATTGCCTGTAATAGATAAGTTTGGAGCTGCTATGGCCCTTGTTAAATCTGACATAGGTGGTAACATATCGAGATTGGAAACTATGTATTCTTCCAATCCAACCAGATTTAACTACCTGTACAGTTTGGTACAGGTAGAGGTTGAAACTAAAACAGCTAAATCATCATCCAGTTGTACCAATGGACTTCTTTGGCTCACAAGAGCAATGGATTTCTTGGTGGCTTTGTTCCGAAACTTAATCGAGCATGAAGATTGGCCAATGTCACAAGCATGTACAGATTCGTATAACAAGACTCTGAAGAAGTGGCATGGCTGGCTTGCTAGTTCAAGCTTCACAGTAGTCATGAAGCTTGCTCCTGATAGGAAGAAGTTTATGGACGTGATAGGAGGCACTGGCAATATCAGTGCTGACATTGAGAAATTTTGTACAACCTTTTCTCCTCTCCTTGAAGAGAATCACAAGTTTTTGGCTCGATTTGGCTTAGATGATATGAAGGCATCATGA

>Glyma02g00670.1   sequence type=predicted peptide   gene model=Glyma02g00670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGTVFTPALQEIEHVKSDQGEILSKPFLDACKHILPVIDKFGAAMALVKSDIGGNISRLETMYSSNPTRFNYLYSLVQVEVETKTAKSSSSCTNGLLWLTRAMDFLVALFRNLIEHEDWPMSQACTDSYNKTLKKWHGWLASSSFTVVMKLAPDRKKFMDVIGGTGNISADIEKFCTTFSPLLEENHKFLARFGLDDMKAS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo