SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g00520

Feature Type:gene_model
Chromosome:Gm02
Start:314452
stop:315296
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g00520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_G7LEX5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7LEX5_MEDTR SoyBaseE_val: 2.00E-06ISS

Expression Patterns of Glyma02g00520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g00520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g002600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g00520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g00520
>Glyma02g00520.1   sequence type=CDS   gene model=Glyma02g00520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAGGGTTGACTACAACATGATAATCCACCTCCATCTAGCGAAAATACTTCTGCAAGGGCCACCACCTAAACGCCAACGCATTGCTCAATTAGCTACCCGGTTTATTGAAAGTTTCAACGACAAAATGGATGCGCTGATGACCCATTTTGGAAAGATTGCTGACAAATGCCAGATTATTCACAGTTGGATCCTTCAAAAAGGGATTTGGTTGGAGAGGTTAACAAATTAG
Predicted protein sequences of Glyma02g00520
>Glyma02g00520.1   sequence type=predicted peptide   gene model=Glyma02g00520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMRVDYNMIIHLHLAKILLQGPPPKRQRIAQLATRFIESFNDKMDALMTHFGKIADKCQIIHSWILQKGIWLERLTN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo