Report for Sequence Feature Glyma02g00450
Feature Type: gene_model
Chromosome: Gm02
Start: 247329
stop: 250238
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma02g00450
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G14640 AT
Annotation by Michelle Graham. TAIR10: calmodulin 8 | chr4:8397800-8399996 FORWARD LENGTH=151
SoyBase E_val: 5.00E-85 ISS
GO:0005513 GO-bp
Annotation by Michelle Graham. GO Biological Process: detection of calcium ion
SoyBase N/A ISS
GO:0009612 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus
SoyBase N/A ISS
GO:0019722 GO-bp
Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling
SoyBase N/A ISS
GO:0030048 GO-bp
Annotation by Michelle Graham. GO Biological Process: actin filament-based movement
SoyBase N/A ISS
GO:0051645 GO-bp
Annotation by Michelle Graham. GO Biological Process: Golgi localization
SoyBase N/A ISS
GO:0051646 GO-bp
Annotation by Michelle Graham. GO Biological Process: mitochondrion localization
SoyBase N/A ISS
GO:0060151 GO-bp
Annotation by Michelle Graham. GO Biological Process: peroxisome localization
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005509 GO-mf
Annotation by Michelle Graham. GO Molecular Function: calcium ion binding
SoyBase N/A ISS
KOG0027
KOG
Calmodulin and related proteins (EF-Hand superfamily)
JGI ISS
PTHR23050 Panther
CALCIUM BINDING PROTEIN
JGI ISS
PTHR23050:SF20 Panther
CALMODULIN
JGI ISS
PF00036 PFAM
EF hand
JGI ISS
UniRef100_I1JB53 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JB53_SOYBN
SoyBase E_val: 2.00E-100 ISS
UniRef100_Q43447 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin n=1 Tax=Glycine max RepID=Q43447_SOYBN
SoyBase E_val: 3.00E-97 ISS
Expression Patterns of Glyma02g00450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma02g00450
Paralog Evidence Comments
Glyma10g00470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma02g00450 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.02g002100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma02g00450
Coding sequences of Glyma02g00450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma02g00450.1 sequence type=CDS gene model=Glyma02g00450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGATGTTCTGAGTGAAGAACAGATTAGTGAGATCAAAGAAGCCTTTGGCTTGTTTGACAAAGATGGAGATGGGTGCATTACTGTGGAAGAATTGGCCACGGTTATCCGGTCATTGGATCAGAACCCCACAGAAGAAGAGCTCCAAGACATGATAAACGAGGTAGATGCAGATGGTAATGGAACCATTGAATTTGTTGAGTTTTTGAACTTAATGGCCAAGAAAATGAAGGAAACTGATGAAGAGGAAGATCTCAAAGAGGCTTTCAAGGTGTTTGACAAGGATCAAAATGGCTACATTTCAGCAAGTGAGTTGAGACACGTTATGATCAATCTGGGTGAAAAACTAACTGATGAGGAGGTGGAGCAGATGATTGAAGAAGCAGATTTGGATGGTGATGGTCAAGTTAATTATGATGAATTTGTCAAGATGATGATGACTATTGGATGA
Predicted protein sequences of Glyma02g00450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma02g00450.1 sequence type=predicted peptide gene model=Glyma02g00450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MADVLSEEQISEIKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMINEVDADGNGTIEFVEFLNLMAKKMKETDEEEDLKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIEEADLDGDGQVNYDEFVKMMMTIG*