Glyma02g00360 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g00360

Feature Type:	gene_model
Chromosome:	Gm02
Start:	153970
stop:	155739
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g00360

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14615	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF2346 (InterPro:IPR018625); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G52825.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037;	SoyBase	E_val: 4.00E-38	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG4702	KOG	Uncharacterized conserved protein	JGI		ISS
PF09803	PFAM	Uncharacterized conserved protein (DUF2346)	JGI		ISS
UniRef100_C6T2C6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2C6_SOYBN	SoyBase	E_val: 2.00E-47	ISS

Expression Patterns of Glyma02g00360

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g00360 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g001300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g00360

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g00360

Limit To All Plant Sequences

>Glyma02g00360.1   sequence type=CDS   gene model=Glyma02g00360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTCTCTGGGCACTTCCAAAGGGATTCTAGAAATTGCCAAGTTCGGCGTCTATGTCACCGTTCCCATCATTCTCATGTACACTTTCGCCAACAATCCCAGCAACCTCCGCAAGTTCATGGGACATAGGTCATACATTGAATATCCCCCAGAGGCAGAAAAGCCACCATCACCGGAGGAACTTAGGGAAATGGCACGGGAGATGGCTCGTAAAAGGAACAGTTCTTGA

Predicted protein sequences of Glyma02g00360

Limit To All Plant Sequences

>Glyma02g00360.1   sequence type=predicted peptide   gene model=Glyma02g00360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLGTSKGILEIAKFGVYVTVPIILMYTFANNPSNLRKFMGHRSYIEYPPEAEKPPSPEELREMAREMARKRNSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain