|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G78560 | AT | Annotation by Michelle Graham. TAIR10: Sodium Bile acid symporter family | chr1:29546846-29548764 REVERSE LENGTH=401 | SoyBase | E_val: 8.00E-14 | ISS |
GO:0006814 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sodium ion transport | SoyBase | N/A | ISS |
GO:0035725 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sodium ion transmembrane transport | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
GO:0008508 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: bile acid:sodium symporter activity | SoyBase | N/A | ISS |
UniRef100_B9N7S4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Bile acid:Na+ symporter family protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N7S4_POPTR | SoyBase | E_val: 1.00E-15 | ISS |
UniRef100_B9N7S4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Bile acid:Na+ symporter family protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N7S4_POPTR | SoyBase | E_val: 1.00E-15 | ISS |
Glyma02g00310 not represented in the dataset |
Glyma02g00310 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g00310.1 sequence type=CDS gene model=Glyma02g00310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACTCCCTTTTTAACAGCTCAATTTGTTGGAAAATATGAAGCTGTGGATGTAATTGACTTACTGATATCAACATTGAAAGTTGTGTTTCTTCCTGTGTTGGTTGGTGCATTTCTTAATCAATATTTCCAATCTCTTGTTAAATTTGGCATGCAG
>Glyma02g00310.1 sequence type=predicted peptide gene model=Glyma02g00310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTPFLTAQFVGKYEAVDVIDLLISTLKVVFLPVLVGAFLNQYFQSLVKFGMQ
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||