SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g00310

Feature Type:gene_model
Chromosome:Gm02
Start:101367
stop:101616
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g00310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G78560AT Annotation by Michelle Graham. TAIR10: Sodium Bile acid symporter family | chr1:29546846-29548764 REVERSE LENGTH=401 SoyBaseE_val: 8.00E-14ISS
GO:0006814GO-bp Annotation by Michelle Graham. GO Biological Process: sodium ion transport SoyBaseN/AISS
GO:0035725GO-bp Annotation by Michelle Graham. GO Biological Process: sodium ion transmembrane transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0008508GO-mf Annotation by Michelle Graham. GO Molecular Function: bile acid:sodium symporter activity SoyBaseN/AISS
UniRef100_B9N7S4UniRef Annotation by Michelle Graham. Best UniRef hit: Bile acid:Na+ symporter family protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N7S4_POPTR SoyBaseE_val: 1.00E-15ISS
UniRef100_B9N7S4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bile acid:Na+ symporter family protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N7S4_POPTR SoyBaseE_val: 1.00E-15ISS

Expression Patterns of Glyma02g00310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g00310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g00310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g00310
>Glyma02g00310.1   sequence type=CDS   gene model=Glyma02g00310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTCCCTTTTTAACAGCTCAATTTGTTGGAAAATATGAAGCTGTGGATGTAATTGACTTACTGATATCAACATTGAAAGTTGTGTTTCTTCCTGTGTTGGTTGGTGCATTTCTTAATCAATATTTCCAATCTCTTGTTAAATTTGGCATGCAG
Predicted protein sequences of Glyma02g00310
>Glyma02g00310.1   sequence type=predicted peptide   gene model=Glyma02g00310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTPFLTAQFVGKYEAVDVIDLLISTLKVVFLPVLVGAFLNQYFQSLVKFGMQ






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo