SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g00310

Feature Type:gene_model
Chromosome:Gm02
Start:101367
stop:101616
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G78560AT Annotation by Michelle Graham. TAIR10: Sodium Bile acid symporter family | chr1:29546846-29548764 REVERSE LENGTH=401 SoyBaseE_val: 8.00E-14ISS
GO:0006814GO-bp Annotation by Michelle Graham. GO Biological Process: sodium ion transport SoyBaseN/AISS
GO:0035725GO-bp Annotation by Michelle Graham. GO Biological Process: sodium ion transmembrane transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0008508GO-mf Annotation by Michelle Graham. GO Molecular Function: bile acid:sodium symporter activity SoyBaseN/AISS
UniRef100_B9N7S4UniRef Annotation by Michelle Graham. Best UniRef hit: Bile acid:Na+ symporter family protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N7S4_POPTR SoyBaseE_val: 1.00E-15ISS
UniRef100_B9N7S4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bile acid:Na+ symporter family protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N7S4_POPTR SoyBaseE_val: 1.00E-15ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g00310.1   sequence type=CDS   gene model=Glyma02g00310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTCCCTTTTTAACAGCTCAATTTGTTGGAAAATATGAAGCTGTGGATGTAATTGACTTACTGATATCAACATTGAAAGTTGTGTTTCTTCCTGTGTTGGTTGGTGCATTTCTTAATCAATATTTCCAATCTCTTGTTAAATTTGGCATGCAG

>Glyma02g00310.1   sequence type=predicted peptide   gene model=Glyma02g00310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTPFLTAQFVGKYEAVDVIDLLISTLKVVFLPVLVGAFLNQYFQSLVKFGMQ







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo