Glyma02g00240 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g00240

Feature Type:	gene_model
Chromosome:	Gm02
Start:	27190
stop:	28522
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g00240

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G43750	AT	Annotation by Michelle Graham. TAIR10: NAD(P)H dehydrogenase 18 \| chr5:17580100-17581145 REVERSE LENGTH=212	SoyBase	E_val: 5.00E-67	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1JB34	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JB34_SOYBN	SoyBase	E_val: 8.00E-120	ISS
UniRef100_Q9FG89	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H dehydrogenase 18 n=1 Tax=Arabidopsis thaliana RepID=Q9FG89_ARATH	SoyBase	E_val: 3.00E-64	ISS

Expression Patterns of Glyma02g00240

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g00240

Paralog	Evidence	Comments
Glyma10g00310	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g00240 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g000300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g00240

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g00240

Limit To All Plant Sequences

>Glyma02g00240.1   sequence type=CDS   gene model=Glyma02g00240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCTTTCACTTGCTTCTCTCTTTTTCTGTCCTTTTGCTTGTGATGATGGGTTTCATTTCTTTTCCTTCATGTAAATTTCAGGATGATTTTGTGTATGGAATATATGATGACCACCACACTTACCACGAAGGAGAACAGAAAGGAACATTTTGGGGCTCAATTGCAGAAGAGATGGCAGTAGCAGAACCCCCCACTGGATTCCAGGGGATTATTTCATGGCTCTTCCCACCAGCCATTGCTCTTGGGGTGTACTTCAATGTTCCGGGGGAGTACTTATACATAGGAGCAGGCATATTTACAATCATATTTTGCATTATTGAGATGGATAAACCTGATAAACCCCACCACTTTGAACCTCACATATACAATATGGAAATGGGAGCTCGAGACAAGTTGATAAATGACTATAATACTACGAGCATATGGGAATTCAATGAAAAATATGGGGACCTATGGGATACTACTATTATTATCAAGAAGGATGACATTATGAAGAGATAA

Predicted protein sequences of Glyma02g00240

Limit To All Plant Sequences

>Glyma02g00240.1   sequence type=predicted peptide   gene model=Glyma02g00240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLFHLLLSFSVLLLVMMGFISFPSCKFQDDFVYGIYDDHHTYHEGEQKGTFWGSIAEEMAVAEPPTGFQGIISWLFPPAIALGVYFNVPGEYLYIGAGIFTIIFCIIEMDKPDKPHHFEPHIYNMEMGARDKLINDYNTTSIWEFNEKYGDLWDTTIIIKKDDIMKR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain