Glyma0220s00210

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma0220s00210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma0220s00210): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma0220s00210

Feature Type:	gene_model
Chromosome:	scaffold_220
Start:	12354
stop:	13331
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma0220s00210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07370	AT	Annotation by Michelle Graham. TAIR10: carboxyl terminus of HSC70-interacting protein \| chr3:2358323-2360301 REVERSE LENGTH=278	SoyBase	E_val: 1.00E-80	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009266	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009610	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to symbiotic fungus	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0000151	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0051087	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chaperone binding	SoyBase	N/A	ISS
PTHR26224	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR26224:SF27	Panther		JGI		ISS
PF04564	PFAM	U-box domain	JGI		ISS
UniRef100_G7LEE6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase CHIP n=1 Tax=Medicago truncatula RepID=G7LEE6_MEDTR	SoyBase	E_val: 2.00E-96	ISS
UniRef100_I1JB24	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JB24_SOYBN	SoyBase	E_val: 4.00E-136	ISS

Expression Patterns of Glyma0220s00210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma0220s00210 not represented in the dataset	Glyma0220s00210 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma0220s00210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g085300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma0220s00210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma0220s00210

Limit To All Plant Sequences

>Glyma0220s00210.1   sequence type=CDS   gene model=Glyma0220s00210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGATGATTCTCGTATTGTTTGTGATCATAATAAGGCTTTGGATCTTGGAAGAGGTGCCAATCCCAAGGGCTATATGGTAGAAGAAATATGGCAAGAGCTTGCAAAGGCAAAACACCTTGAGTGGGAACGATCATCGTCCAAACGATCATGGGAATTGCAGAGCTTGAAAGAAGCTTGTGAGTCGGCTTTGAAGGAAAAACATTTTCTTGATTACTCCCAAATGGAAGGATTTGTGGATGACGCTACTACTTCCCATTCAGAACAATTAGAGGCTTTAGAAAAAGTCTTCAATACAACTGCAGAGGCTGACACACCTACCGAGGTGCCAGATTATTTGTGCTGTAGAATCACACTCGACATTTTTCTTGATCTTGTAATCACTCGAAGTGGACTTACATATGAGAGAGCTGTGATTCTTGAACATCTTCAGAAGGTTGGTAAATTCAACCCAATCACACGAGAACCCCTTGATCCATCACAGTTAGTGCCAAACTTGGCCATTAAGGAAGCGGTCGAGGCATTCTTGGACAAACATGGATGGGCCTGCAAGATTGATTAA

Predicted protein sequences of Glyma0220s00210

Limit To All Plant Sequences

>Glyma0220s00210.1   sequence type=predicted peptide   gene model=Glyma0220s00210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFDDSRIVCDHNKALDLGRGANPKGYMVEEIWQELAKAKHLEWERSSSKRSWELQSLKEACESALKEKHFLDYSQMEGFVDDATTSHSEQLEALEKVFNTTAEADTPTEVPDYLCCRITLDIFLDLVITRSGLTYERAVILEHLQKVGKFNPITREPLDPSQLVPNLAIKEAVEAFLDKHGWACKID*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain