SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g45481): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g45481): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g45481

Feature Type:gene_model
Chromosome:Gm01
Start:55727596
stop:55728565
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g45481
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G19508AT Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: mitochondrion; Has 34 Blast hits to 34 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:6762378-6762696 REVERSE LENGTH=81 SoyBaseE_val: 1.00E-32ISS
UniRef100_A9SNJ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: UPF0631 protein n=1 Tax=Physcomitrella patens subsp. patens RepID=U631_PHYPA SoyBaseE_val: 9.00E-15ISS
UniRef100_UPI0002337B20UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337B20 related cluster n=1 Tax=unknown RepID=UPI0002337B20 SoyBaseE_val: 3.00E-51ISS

Expression Patterns of Glyma01g45481
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g45481 not represented in the dataset
Glyma01g45481 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g45481 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g243800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g45481
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g45481
>Glyma01g45481.1   sequence type=CDS   gene model=Glyma01g45481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAGGCGGTGAGAGCGTATGCGGAGGTTCTGAGATTGGTGAGGCTCTTACCAAAGGACAGCAGGGCTTATTATGCCAAGTACGCCCGCGAGAACTTCGTCAATTACCGTGATGTCGTTGATCCTTCTGATTTCGATGACCTCTTTCAACGCACCTATACTCATTCTCTATGGGTCCTTCATAAGTATTCCATTGATAAATCTGCTGCGGATAAGCTCAGAGGGATATGCTGCACTTGA
Predicted protein sequences of Glyma01g45481
>Glyma01g45481.1   sequence type=predicted peptide   gene model=Glyma01g45481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKAVRAYAEVLRLVRLLPKDSRAYYAKYARENFVNYRDVVDPSDFDDLFQRTYTHSLWVLHKYSIDKSAADKLRGICCT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo