SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g45250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g45250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g45250

Feature Type:gene_model
Chromosome:Gm01
Start:55633920
stop:55634837
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G14660AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Uncharacterised protein family UPF0310 (InterPro:IPR002740); Has 2761 Blast hits to 2761 proteins in 686 species: Archae - 5; Bacteria - 1143; Metazoa - 73; Fungi - 78; Plants - 42; Viruses - 0; Other Eukaryotes - 1420 (source: NCBI BLink). | chr2:6272506-6272982 FORWARD LENGTH=158 SoyBaseE_val: 3.00E-63ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3383 KOG Uncharacterized conserved protein JGI ISS
PTHR14087Panther UNCHARACTERIZED JGI ISS
PTHR14087:SF4Panther UNCHARACTERIZED JGI ISS
PF01878PFAM Protein of unknown function DUF55 JGI ISS
UniRef100_G7K0Z2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thymocyte nuclear protein n=1 Tax=Medicago truncatula RepID=G7K0Z2_MEDTR SoyBaseE_val: 4.00E-77ISS
UniRef100_I1JAX2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JAX2_SOYBN SoyBaseE_val: 2.00E-96ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g45250 not represented in the dataset

Glyma01g45250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g241600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g45250.1   sequence type=CDS   gene model=Glyma01g45250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAAGGAGAAGAAGAGGTATCTTCTGAAAACGGAACCGTCGGAGTGGTCGTGGGAGGACCAGGCAGCAAACGGAGGCATAAGCAAATGGGATGGGGTGAAGAACAAGCAGGCCCAGAAATACCTCAAGTCCATGTCCATCAACGACCTCTGCTTCTTCTACCACTCCGGCCCCAAGGCCCGCCGTATCGTCGGCGTTGTTTCCGTCGTCCGCGAGTGGTACGGCGATGCTGTCGACGTCAAGGCTGTCGGGGAGATGAGGAGGCCCGTCGACTTAAAGGAGATGAAACATTTCAAGGATTTCGCTCTCTTGAGGCAACCTAGGCTCTCTGTTGTCCCTGTTCCCGATCACATTTGGAACCAAATCTGTCATTTGGGAGGTGGCTACCAAGGCGACCATGCTTCCTAA

>Glyma01g45250.1   sequence type=predicted peptide   gene model=Glyma01g45250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKEKKRYLLKTEPSEWSWEDQAANGGISKWDGVKNKQAQKYLKSMSINDLCFFYHSGPKARRIVGVVSVVREWYGDAVDVKAVGEMRRPVDLKEMKHFKDFALLRQPRLSVVPVPDHIWNQICHLGGGYQGDHAS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo