SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g44816): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g44816): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g44816

Feature Type:gene_model
Chromosome:Gm01
Start:55335390
stop:55338159
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g44816
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14870AT Annotation by Michelle Graham. TAIR10: secE/sec61-gamma protein transport protein | chr4:8517248-8517781 FORWARD LENGTH=177 SoyBaseE_val: 6.00E-32ISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0009306GO-bp Annotation by Michelle Graham. GO Biological Process: protein secretion SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0015450GO-mf Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity SoyBaseN/AISS
UniRef100_D7MBA8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein translocase n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MBA8_ARALL SoyBaseE_val: 7.00E-30ISS
UniRef100_I1JAT3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JAT3_SOYBN SoyBaseE_val: 3.00E-64ISS

Expression Patterns of Glyma01g44816
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g44816 not represented in the dataset
Glyma01g44816 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g44816 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g237800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g44816
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g44816
>Glyma01g44816.1   sequence type=CDS   gene model=Glyma01g44816   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGTGCAAGCTTTCTATCACTTAGGGTCACCGCTGACGTCACAGTCACACTTTCCATCACCCCCTCTCCGACTCACACTCACTGCTTCCGCGCCCTTCAAGCCCCGACCCCTCGCTTCCATCGGAATCTCGCCGCTCCCGGAGAGGCGCCGGATGCCGGTGGCCGGCGCCGTGGAGGAAAGCCAAGAGAGTTCCGAACCGGAAGCGGAAGCGGATTTGGCATCGGAACTGAAGAAGGCGATGGCGGAGAGGAAAGAGAAAGAAGAGGAGAACATGTTGAGCGGAGTGGCGCGTGAGATCGACGAGATTGAATGGCCCGCGTTCGGGAAAGTATTGGGTACCACCGGCGTTGTCCTCAGCGTTATTTTTGGTTCCAGCGTCGTTTTGCTCAGCGTCAATGCCGTTTTGGCCGAGATTTCTGATCGGGTTTTTGCTGGCAAAGGGATCCAGGATTTCTTCACCTGA
Predicted protein sequences of Glyma01g44816
>Glyma01g44816.1   sequence type=predicted peptide   gene model=Glyma01g44816   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVQAFYHLGSPLTSQSHFPSPPLRLTLTASAPFKPRPLASIGISPLPERRRMPVAGAVEESQESSEPEAEADLASELKKAMAERKEKEEENMLSGVAREIDEIEWPAFGKVLGTTGVVLSVIFGSSVVLLSVNAVLAEISDRVFAGKGIQDFFT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo