SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g44750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g44750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g44750

Feature Type:gene_model
Chromosome:Gm01
Start:55303659
stop:55304908
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g44750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22540AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1677) | chr3:7984233-7984565 REVERSE LENGTH=110 SoyBaseE_val: 4.00E-49ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF07911PFAM Protein of unknown function (DUF1677) JGI ISS
UniRef100_I1JAS3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JAS3_SOYBN SoyBaseE_val: 1.00E-82ISS
UniRef100_Q10RG2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10RG2_ORYSJ SoyBaseE_val: 4.00E-25ISS

Expression Patterns of Glyma01g44750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g44750 not represented in the dataset
Glyma01g44750 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g44750
ParalogEvidenceComments
Glyma11g00860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g44750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g237000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g44750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g44750
>Glyma01g44750.1   sequence type=CDS   gene model=Glyma01g44750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAATTGAATCGGTCAAGTGTGAGTGCTGTGGCCTCAAAGAGGATTGCACCCAAGAATATATCCGCGATGTGAAGGCTAAGTTTGACAGCAAATGGTTATGTGGTTTGTGCTCAGAAGCAGTGAGAGATGAAGTTAACAGAGCGAAAAGGCCTTTTGCTATGGAGGAAGCTGTGAAGGCTCACATGTCATTCTGTGGGAAGATCAAATCGAATCCCGCAGTAAGAGTCGCTGATGGCATGAGGCAGATGCTAAGGAGAAGGTCAACTGACTTGTCTTCATCGTCAAGCAAGTACAGTGGCAGGTCAAACACCACTTCTCAAGTCACTGATTCCTCCACGTTCCCATTGCACCCATGA
Predicted protein sequences of Glyma01g44750
>Glyma01g44750.1   sequence type=predicted peptide   gene model=Glyma01g44750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEIESVKCECCGLKEDCTQEYIRDVKAKFDSKWLCGLCSEAVRDEVNRAKRPFAMEEAVKAHMSFCGKIKSNPAVRVADGMRQMLRRRSTDLSSSSSKYSGRSNTTSQVTDSSTFPLHP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo