Glyma01g44150 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g44150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g44150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g44150

Feature Type:	gene_model
Chromosome:	Gm01
Start:	54917206
stop:	54919421
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g44150

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G71480	AT	Annotation by Michelle Graham. TAIR10: Nuclear transport factor 2 (NTF2) family protein \| chr1:26932079-26933086 FORWARD LENGTH=216	SoyBase	E_val: 1.00E-68	ISS
GO:0006606	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into nucleus	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0015996	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll catabolic process	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0008565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein transporter activity	SoyBase	N/A	ISS
PF02136	PFAM	Nuclear transport factor 2 (NTF2) domain	JGI		ISS
UniRef100_I1JAK4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JAK4_SOYBN	SoyBase	E_val: 7.00E-86	ISS
UniRef100_Q9C9I5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT1G71480 protein n=1 Tax=Arabidopsis thaliana RepID=Q9C9I5_ARATH	SoyBase	E_val: 7.00E-66	ISS

Expression Patterns of Glyma01g44150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g44150 not represented in the dataset	Glyma01g44150 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g44150

Paralog	Evidence	Comments
Glyma11g01650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g44150 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g44150

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g44150

Limit To All Plant Sequences

>Glyma01g44150.1   sequence type=CDS   gene model=Glyma01g44150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAGAATTGTGTGTATGAAGATCTTGTCTTTCCCCGACCCTTTGTTGGTCGTAAGGAAATTCTAGAGTTCTTCAAAAAATTCACTAATTCTACCAGCAAAGGTCTGCAGTTTGTTATTGATGATTTGTCTACTGAGGACTCCTCATCTGTCGGGGTGATATGGCATTTGGAATGGAAGGGAAAACCTTTTCCCTTTAGCAAAGGGTGCAGTTTTTATCGTCTAGAGGTGATCAATGGCAAAAGACAAATAACATATGGACGAGACTGTGTTGAACCTGCAATCAAGCCTGGGGATGCAGCTTTGGCAGCGATCAGGAGTGTGACATGGCTACTGCAGCAATTTCCTCAGTTGGCAAACTGGTTATAG

Predicted protein sequences of Glyma01g44150

Limit To All Plant Sequences

>Glyma01g44150.1   sequence type=predicted peptide   gene model=Glyma01g44150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAENCVYEDLVFPRPFVGRKEILEFFKKFTNSTSKGLQFVIDDLSTEDSSSVGVIWHLEWKGKPFPFSKGCSFYRLEVINGKRQITYGRDCVEPAIKPGDAALAAIRSVTWLLQQFPQLANWL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain