SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g44140

Feature Type:gene_model
Chromosome:Gm01
Start:54915715
stop:54916224
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g44140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71450AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr1:26927088-26927639 FORWARD LENGTH=183 SoyBaseE_val: 9.00E-64ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7K7X9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7K7X9_MEDTR SoyBaseE_val: 4.00E-81ISS
UniRef100_I1JAK3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JAK3_SOYBN SoyBaseE_val: 5.00E-122ISS

Expression Patterns of Glyma01g44140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g44140
ParalogEvidenceComments
Glyma11g01640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g44140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g231200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g44140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g44140
>Glyma01g44140.1   sequence type=CDS   gene model=Glyma01g44140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCTGCATACCGTGGCGTCCGCAAGAGGAAATGGGGGAAGTGGGTGTCAGAAATCCGCGAGCCAGGAACCAAGACAAGAATCTGGCTCGGCAGTTTCGAGACTCCCGAGATGGCGGCGGCAGCATACGACGTCGCAGCGTTGCATTTCAGGGGCCGCGACGCCAGGCTCAACTTCCCTGAGCTCGCCAGCACCCTGCCACGCCCCGTCAGTAACAATGCTGACCACATACGCATGGCGGCGCACCAGGCCGCTCTCAGGCTCCGGACAAACCCCGCCGCTCCCGACACCGCTGGCTCCGCCGGTTCCTCCTCCTCTGCTCCCCTCACCGTGAGGCTCTCCCCCACTCAGATTCAGGCCATCAATGACTCCCCCATGGACTCACCACAAACTTGGATGCAAATGCCTGACACTTTCATGATGCATGATCAGTCCATGATGTTCGCAAGCAACGGCTATTCGTTTGAGGACAACGAGTGGGAGCATATGCAGAATGATTCTCTTTGGGATCCT
Predicted protein sequences of Glyma01g44140
>Glyma01g44140.1   sequence type=predicted peptide   gene model=Glyma01g44140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SAYRGVRKRKWGKWVSEIREPGTKTRIWLGSFETPEMAAAAYDVAALHFRGRDARLNFPELASTLPRPVSNNADHIRMAAHQAALRLRTNPAAPDTAGSAGSSSSAPLTVRLSPTQIQAINDSPMDSPQTWMQMPDTFMMHDQSMMFASNGYSFEDNEWEHMQNDSLWDP






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo