Glyma01g44040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g44040

Feature Type:	gene_model
Chromosome:	Gm01
Start:	54855457
stop:	54859976
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g44040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G03150	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G17165.1); Has 39 Blast hits to 39 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:727733-729357 REVERSE LENGTH=121	SoyBase	E_val: 1.00E-22	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_C6TF57	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TF57_SOYBN	SoyBase	E_val: 2.00E-89	ISS
UniRef100_J7F198	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hydrogen peroxide induced protein 1 n=2 Tax=Camellia sinensis RepID=J7F198_CAMSI	SoyBase	E_val: 3.00E-28	ISS

Expression Patterns of Glyma01g44040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g44040

Paralog	Evidence	Comments
Glyma11g01520	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g44040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g230200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g44040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g44040

Limit To All Plant Sequences

>Glyma01g44040.1   sequence type=CDS   gene model=Glyma01g44040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCCAATTCGAGTAGCCGAGGGATCACCGCCTTGGGGAAGCGAGTCGCCAACCAGATCTGGACTTCCAACCCCCCCTCAGCTCCTCTCACTTCCAGGAGGGGAGCAATAGCAGCTGCCTACAGTAGCAGCGGCGGGTCAGTGTATGACAAGAACCCTGATGATCAGATCCACTCTGGGGCGGTCCCAGACGATGTGATCCAGGCAACACAATCCGGCAAATACTGGGCCCCACACCCACAGACTGGGGTATTTGGGCCCCCCGGAGGAGCAGGAGACGAAGCTGCATCTGCTCCCACTTCCACTTCCACTTCCACTTCTGATGCCCTGGAGGAGAAGGCCTGGTTTCGCCCCACCAGTCTCGAGGATTTCGAGAAGCCTCACACCCTTCCTTAA

Predicted protein sequences of Glyma01g44040

Limit To All Plant Sequences

>Glyma01g44040.1   sequence type=predicted peptide   gene model=Glyma01g44040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAANSSSRGITALGKRVANQIWTSNPPSAPLTSRRGAIAAAYSSSGGSVYDKNPDDQIHSGAVPDDVIQATQSGKYWAPHPQTGVFGPPGGAGDEAASAPTSTSTSTSDALEEKAWFRPTSLEDFEKPHTLP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain