Glyma01g42991 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g42991): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g42991): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g42991

Feature Type:	gene_model
Chromosome:	Gm01
Start:	54099269
stop:	54099940
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g42991

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G41350	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr5:16542026-16543092 REVERSE LENGTH=212	SoyBase	E_val: 1.00E-23	ISS
GO:0006914	GO-bp	Annotation by Michelle Graham. GO Biological Process: autophagy	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR22766	Panther	RING FINGER PROTEIN 24-RELATED	JGI		ISS
PTHR22766:SF20	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_B9RCE8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RCE8_RICCO	SoyBase	E_val: 9.00E-31	ISS
UniRef100_UPI0002336B80	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002336B80 related cluster n=1 Tax=unknown RepID=UPI0002336B80	SoyBase	E_val: 7.00E-122	ISS

Expression Patterns of Glyma01g42991

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g42991 not represented in the dataset	Glyma01g42991 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g42991 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g221000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g42991

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g42991

Limit To All Plant Sequences

>Glyma01g42991.1   sequence type=CDS   gene model=Glyma01g42991   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGCCTTATCTGCAGAACCCAGCGAGAGTATCGGAGGTGCATGTGCCACAATCATTTCGCCAAGGTTCTCCTCCTGCTGTTTCCGGGGGACTCTTAAATGATACTTCTAGACGGACTCTTGACTTTTTCCTTTCCGATTTGCCTTTGGGTGTCACTCAAGAAATCTGTGCTGACCAGACCAATACATCGCTGCAAACTATAGATTCTACTTCAACTAAAAAAACAGTTGATGGTGACAATTATGAGACTGGGACCTCATCTAAGTCAGAAAAACTGAAGGAATCAGTATGCAAAACCCAGACGGCTTTGAAACTTGGCTCGGCAAAGGGTTCTGAACTTGAACTTGCAAAGTTGGGAAAAGCTGTCATCTTAGATGAAGAGGAGAGTGCATGCCCAATTTATTTAGGAGAGTATGATGCTGAGAATCCAAAAATATTCACACAATGTGACCATCATGTTCACATTGAATGCATTCATGATTGGATGAAAAGAAACAGCCTTTGCCCTGTGTGTAATAAGGTTTGTCATCTTAATTAA

Predicted protein sequences of Glyma01g42991

Limit To All Plant Sequences

>Glyma01g42991.1   sequence type=predicted peptide   gene model=Glyma01g42991   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LPYLQNPARVSEVHVPQSFRQGSPPAVSGGLLNDTSRRTLDFFLSDLPLGVTQEICADQTNTSLQTIDSTSTKKTVDGDNYETGTSSKSEKLKESVCKTQTALKLGSAKGSELELAKLGKAVILDEEESACPIYLGEYDAENPKIFTQCDHHVHIECIHDWMKRNSLCPVCNKVCHLN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain